You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CASP7
Caspase-7

Protein Summary
Description
Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death. This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000345633
  • ENSP00000298701
  • ENSG00000165806
  • ENST00000369315
  • ENSP00000358321
  • ENST00000369318
  • ENSP00000358324
  • ENST00000369331
  • ENSP00000358337
  • ENST00000452490
  • ENSP00000398107
  • ENST00000614447
  • ENSP00000478285
  • ENST00000621345
  • ENSP00000480584
  • ENST00000621607
  • ENSP00000478999

Symbol
  • MCH3
  • MCH3
  • CMH-1
  • LICE2
  • CASP-7
  • ICE-LAP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
virus perturbation
1
hub protein
0.88
protein domain
0.85
gene perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 464.87   (req: < 5)
Gene RIFs: 83   (req: <= 3)
Antibodies: 991   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 464.87   (req: >= 5)
Gene RIFs: 83   (req: > 3)
Antibodies: 991   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 327
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (41)
1 – 5 of 41
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (108)
Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of caspases through apoptosome-mediated cleavage
Reactome
Apoptosis
Reactome
Apoptotic cleavage of cellular proteins
Reactome
Apoptotic execution phase
Reactome
Apoptotic factor-mediated response
Name
Explore in Pharos
Explore in Source
Activation of caspases through apoptosome-mediated cleavage
Apoptosis
Apoptotic cleavage of cellular proteins
Apoptotic execution phase
Apoptotic factor-mediated response
Gene Ontology Terms (13)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (201)
1 – 10 of 201
CASP8
Tchem
Family: Enzyme
Novelty: 0.00026844
Score: 0.999
Data Source: STRINGDB
XIAP
Tchem
Family: Enzyme
Novelty: 0.00068225
Score: 0.996
Data Source: Reactome,STRINGDB
APAF1
Tbio
Family: Enzyme
Novelty: 0.00164778
Score: 0.993
Data Source: STRINGDB
BIRC2
Tchem
Novelty: 0.00265344
Score: 0.99
Data Source: STRINGDB
CASP10
Tchem
Family: Enzyme
Novelty: 0.01037136
Score: 0.988
Data Source: STRINGDB
CYCS
Tchem
Novelty: 0.00018258
Score: 0.981
Data Source: STRINGDB
BIRC3
Tchem
Novelty: 0.00226316
Score: 0.981
Data Source: STRINGDB
PARP1
Tclin
Family: Enzyme
Novelty: 0.00042675
Score: 0.981
Data Source: STRINGDB
CASP2
Tchem
Family: Enzyme
Novelty: 0.00224248
Score: 0.966
Data Source: STRINGDB
GZMB
Tchem
Family: Enzyme
Novelty: 0.00040843
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  464.87

PubMed score by year
PubTator Score  905.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKC
1-70
IIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACI
70-140
LLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPR
140-210
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDP
210-280
HFHEKKQIPCVVSMLTKELYFSQ
280-303
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ