You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LOR
Loricrin

Protein Summary
Description
Major keratinocyte cell envelope protein. This gene encodes loricrin, a major protein component of the cornified cell envelope found in terminally differentiated epidermal cells. Mutations in this gene are associated with Vohwinkel's syndrome and progressive symmetric erythrokeratoderma, both inherited skin diseases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368742
  • ENSP00000357731
  • ENSG00000203782

Symbol
  • LRN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.94
cell type or tissue
0.7
PubMedID
0.66
tissue sample
0.53
cellular component
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.19   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 71   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.19   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 71   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Formation of the cornified envelope
Reactome
Keratinization
Name
Explore in Pharos
Explore in Source
Developmental Biology
Formation of the cornified envelope
Keratinization
Protein-Protein Interactions (114)
1 – 10 of 114
DTL
Tbio
Novelty: 0.01976973
p_int: 0.99682599
p_ni: 0.00317116
p_wrong: 0.000002849
Data Source: BioPlex
AAAS
Tbio
Novelty: 0.00123328
p_int: 0.983774221
p_ni: 0.016224842
p_wrong: 9.37e-7
Data Source: BioPlex
B3GALNT1
Tbio
Family: Enzyme
Novelty: 0.00535685
p_int: 0.972346378
p_ni: 0.02725486
p_wrong: 0.000398762
Score: 0.217
Data Source: BioPlex,STRINGDB
NDUFS5
Tclin
Family: Enzyme
Novelty: 0.59900166
p_int: 0.971438423
p_ni: 0.028560242
p_wrong: 0.000001335
Data Source: BioPlex
BEX5
Tdark
Novelty: 0.46128501
p_int: 0.88506087
p_ni: 0.113819738
p_wrong: 0.001119392
Data Source: BioPlex
ZSCAN12
Tdark
Family: TF
Novelty: 0.40909091
p_int: 0.798072693
p_ni: 0.076004833
p_wrong: 0.125922474
Data Source: BioPlex
PI4KA
Tchem
Family: Kinase
Novelty: 0.02976615
p_int: 0.791508447
p_ni: 0.137317306
p_wrong: 0.071174247
Score: 0.181
Data Source: BioPlex,STRINGDB
ZDHHC23
Tbio
Family: Enzyme
Novelty: 0.01337423
p_int: 0.780645425
p_ni: 0.093307689
p_wrong: 0.126046886
Score: 0.252
Data Source: BioPlex,STRINGDB
IVL
Tbio
Novelty: 0.00154231
Score: 0.993
Data Source: STRINGDB
FLG
Tbio
Novelty: 0.0009107
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  203.19

PubMed score by year
PubTator Score  211.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSG
1-70
GGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGG
70-140
SGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVS
140-210
SQQVTQTSCAPQPSYGGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGG
210-280
GGGSSVGGSGSGKGVPICHQTQQKQAPTWPSK
280-312
MSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVSSQQVTQTSCAPQPSYGGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKGVPICHQTQQKQAPTWPSK