You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
S100A9
Protein S100-A9

Protein Summary
Description
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368738
  • ENSP00000357727
  • ENSG00000163220

Symbol
  • CAGB
  • CFAG
  • MRP14
  • MIF
  • NIF
  • P14
  • CAGB
  • CFAG
  • CGLB
  • L1AG
  • LIAG
  • MRP14
  • 60B8AG
  • MAC387
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.99
biological process
0.97
protein complex
0.97
small molecule perturbation
0.97
molecular function
0.96


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 904.36   (req: < 5)
Gene RIFs: 363   (req: <= 3)
Antibodies: 1077   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 904.36   (req: >= 5)
Gene RIFs: 363   (req: > 3)
Antibodies: 1077   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 33
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Antimicrobial peptides (R-HSA-6803157)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Antimicrobial peptides
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Metal sequestration by antimicrobial proteins
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Antimicrobial peptides
Immune System
Innate Immune System
Metal sequestration by antimicrobial proteins
Neutrophil degranulation
Gene Ontology Terms (45)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (146)
1 – 10 of 146
TTC39A
Tdark
Novelty: 14
p_int: 0.999999995
p_ni: 5e-9
Data Source: BioPlex
GNPAT
Tchem
Family: Enzyme
Novelty: 0.0152005
p_int: 0.99950791
p_ni: 0.00049209
Data Source: BioPlex
NME2P1
Tdark
Family: Kinase
p_int: 0.996911238
p_ni: 0.003088762
Data Source: BioPlex
TTC4
Tbio
Novelty: 0.01189394
p_int: 0.986578706
p_ni: 0.013421294
Data Source: BioPlex
TBC1D22B
Tbio
Novelty: 6
p_int: 0.954061316
p_ni: 0.045938684
Data Source: BioPlex
PCYOX1
Tbio
Family: Enzyme
Novelty: 0.24200876
p_int: 0.937383014
p_ni: 0.062616986
Data Source: BioPlex
PDE4DIP
Tbio
Novelty: 0.04181178
p_int: 0.930002279
p_ni: 0.069997721
Data Source: BioPlex
PI4KA
Tchem
Family: Kinase
Novelty: 0.02976615
p_int: 0.929092774
p_ni: 0.070907226
Data Source: BioPlex
SUSD3
Tdark
Novelty: 1
p_int: 0.897039958
p_ni: 0.102960042
Score: 0.208
Data Source: BioPlex,STRINGDB
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.870608509
p_ni: 0.129391491
Data Source: BioPlex
Publication Statistics
PubMed Score  904.36

PubMed score by year
PubTator Score  660.32

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA
1-70
DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
70-114
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP