You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BGLAP
Osteocalcin

Protein Summary
Description
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368272
  • ENSP00000357255
  • ENSG00000242252

Symbol
  • OC
  • BGP
  • OCN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.91
disease
0.83
chemical
0.79
phenotype
0.76
biological process
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7694.46   (req: < 5)
Gene RIFs: 193   (req: <= 3)
Antibodies: 906   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7694.46   (req: >= 5)
Gene RIFs: 193   (req: > 3)
Antibodies: 906   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (46)
Gamma carboxylation, hypusine formation and arylsulfatase activation (R-HSA-163841)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Gamma-carboxylation of protein precursors
Reactome
Gamma-carboxylation, transport, and amino-terminal cleavage of proteins
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Gamma carboxylation, hypusine formation and arylsulfatase activation
Gamma-carboxylation of protein precursors
Gamma-carboxylation, transport, and amino-terminal cleavage of proteins
Gene expression (Transcription)
Generic Transcription Pathway
Protein-Protein Interactions (208)
1 – 10 of 208
P3H2
Tbio
Family: Enzyme
Novelty: 0.00315791
p_int: 0.999998788
p_ni: 0.000001212
Data Source: BioPlex
SEH1L
Tbio
Novelty: 0.0895265
p_int: 0.99912467
p_ni: 0.00087533
Data Source: BioPlex
POC1A
Tbio
Novelty: 0.04826931
p_int: 0.949737661
p_ni: 0.006387716
p_wrong: 0.043874623
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.924619029
p_ni: 0.075380971
Data Source: BioPlex
NDUFAF7
Tbio
Family: Enzyme
Novelty: 0.26143791
p_int: 0.817982042
p_ni: 0.181750491
p_wrong: 0.000267467
Data Source: BioPlex
GRN
Tbio
Novelty: 0.00096763
p_int: 0.775823501
p_ni: 0.158687199
p_wrong: 0.0654893
Data Source: BioPlex
GGCX
Tclin
Family: Enzyme
Novelty: 0.01163709
Score: 0.975
Data Source: Reactome,STRINGDB
RUNX2
Tbio
Family: TF
Novelty: 0.00035641
Score: 0.971
Data Source: STRINGDB
PTH
Tbio
Novelty: 0.00003793
Score: 0.957
Data Source: STRINGDB
SP7
Tbio
Family: TF
Novelty: 0.00141584
Score: 0.95
Data Source: STRINGDB
Publication Statistics
PubMed Score  7694.46

PubMed score by year
PubTator Score  6385.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
1-70
REVCELNPDCDELADHIGFQEAYRRFYGPV
70-100
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV