Protein Summary
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 7694.46 (req: < 5)
Gene RIFs: 193 (req: <= 3)
Antibodies: 906 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 7694.46 (req: >= 5)
Gene RIFs: 193 (req: > 3)
Antibodies: 906 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 31
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (46)
Reactome (13)
KEGG (1)
PathwayCommons (5)
WikiPathways (27)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 13
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Gamma carboxylation, hypusine formation and arylsulfatase activation | ||||
Reactome | Gamma-carboxylation of protein precursors | ||||
Reactome | Gamma-carboxylation, transport, and amino-terminal cleavage of proteins | ||||
Reactome | Gene expression (Transcription) | ||||
Reactome | Generic Transcription Pathway | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Gamma carboxylation, hypusine formation and arylsulfatase activation | ||||
Gamma-carboxylation of protein precursors | ||||
Gamma-carboxylation, transport, and amino-terminal cleavage of proteins | ||||
Gene expression (Transcription) | ||||
Generic Transcription Pathway | ||||
Gene Ontology Terms (40)
Functions (4)
Components (9)
Processes (27)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Non-traceable Author Statement (NAS) | ProtInc | |||
Protein-Protein Interactions (208)
1 – 10 of 208
P3H2
Family: Enzyme
Novelty: 0.00315791
p_int: 0.999998788
p_ni: 0.000001212
Data Source: BioPlex
SEH1L
Novelty: 0.0895265
p_int: 0.99912467
p_ni: 0.00087533
Data Source: BioPlex
POC1A
Novelty: 0.04826931
p_int: 0.949737661
p_ni: 0.006387716
p_wrong: 0.043874623
Data Source: BioPlex
HSPA5
Novelty: 0.00051387
p_int: 0.924619029
p_ni: 0.075380971
Data Source: BioPlex
NDUFAF7
Family: Enzyme
Novelty: 0.26143791
p_int: 0.817982042
p_ni: 0.181750491
p_wrong: 0.000267467
Data Source: BioPlex
GRN
Novelty: 0.00096763
p_int: 0.775823501
p_ni: 0.158687199
p_wrong: 0.0654893
Data Source: BioPlex
GGCX
Family: Enzyme
Novelty: 0.01163709
Score: 0.975
Data Source: Reactome,STRINGDB
RUNX2
Family: TF
Novelty: 0.00035641
Score: 0.971
Data Source: STRINGDB
PTH
Novelty: 0.00003793
Score: 0.957
Data Source: STRINGDB
SP7
Family: TF
Novelty: 0.00141584
Score: 0.95
Data Source: STRINGDB
Publication Statistics
PubMed Score 7694.46
PubMed score by year
PubTator Score 6385.92
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
1-70
REVCELNPDCDELADHIGFQEAYRRFYGPV
70-100
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Find similar targets by: