You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD1D
Antigen-presenting glycoprotein CD1d

Protein Summary
Description
Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells. This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368171
  • ENSP00000357153
  • ENSG00000158473

Symbol
  • R3
  • CD1A
  • R3G1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.91
cellular component
0.85
protein domain
0.73
PubMedID
0.72
phenotype
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1973.57   (req: < 5)
Gene RIFs: 133   (req: <= 3)
Antibodies: 477   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1973.57   (req: >= 5)
Gene RIFs: 133   (req: > 3)
Antibodies: 477   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (27)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (192)
1 – 10 of 192
MINDY1
Tbio
Novelty: 0.54545455
p_int: 0.97355054
p_ni: 0.026131208
p_wrong: 0.000318252
Data Source: BioPlex
B2M
Tbio
Novelty: 0.00012184
Score: 0.996
Data Source: Reactome,STRINGDB
CD3E
Tclin
Novelty: 0.00541492
Score: 0.946
Data Source: Reactome,STRINGDB
CD3D
Tclin
Novelty: 0.00372579
Score: 0.924
Data Source: Reactome,STRINGDB
CD3G
Tclin
Novelty: 0.00498635
Score: 0.904
Data Source: Reactome,STRINGDB
CD83
Tbio
Novelty: 0.00171116
Score: 0.862
Data Source: STRINGDB
CSF2
Tbio
Novelty: 0.00012299
Score: 0.842
Data Source: STRINGDB
CD86
Tclin
Novelty: 0.00036476
Score: 0.839
Data Source: STRINGDB
CD68
Tbio
Novelty: 0.00026143
Score: 0.828
Data Source: STRINGDB
PTPRC
Tchem
Family: Enzyme
Novelty: 0.00019614
Score: 0.818
Data Source: STRINGDB
Publication Statistics
PubMed Score  1973.57

PubMed score by year
PubTator Score  746.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKP
1-70
WSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKD
70-140
ILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLS
140-210
RGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR
210-280
VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
280-335
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL