You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD1B
T-cell surface glycoprotein CD1b

Protein Summary
Description
Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368168
  • ENSP00000357150
  • ENSG00000158485

Symbol
  • R1
  • CD1
  • CD1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
metabolite
0.62
biological term
0.54
cellular component
0.5
gene perturbation
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 659.52   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 631   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 659.52   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 631   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (155)
1 – 10 of 155
PODXL2
Tbio
Novelty: 0.24089475
p_int: 0.999930337
p_ni: 0.000069613
p_wrong: 5e-8
Data Source: BioPlex
FCGRT
Tchem
Novelty: 0.0014463
p_int: 0.999870454
p_ni: 0.000123494
p_wrong: 0.000006052
Score: 0.247
Data Source: BioPlex,STRINGDB
NRSN2
Tbio
Novelty: 0.30769231
p_int: 0.999773873
p_ni: 0.000183493
p_wrong: 0.000042634
Score: 0.179
Data Source: BioPlex,STRINGDB
DHFR2
Tbio
Family: Enzyme
Novelty: 0.03421403
p_int: 0.999436638
p_ni: 0.000563361
p_wrong: 1e-9
Data Source: BioPlex
LNPK
Tbio
Novelty: 0.06984866
p_int: 0.997375461
p_ni: 0.002624502
p_wrong: 3.7e-8
Data Source: BioPlex
BTN2A2
Tdark
Novelty: 1.22054223
p_int: 0.996320635
p_ni: 0.003679365
Data Source: BioPlex
PCYOX1L
Tdark
Family: Enzyme
Novelty: 3.12186978
p_int: 0.994270414
p_ni: 0.005637062
p_wrong: 0.000092524
Data Source: BioPlex
AMIGO1
Tbio
Novelty: 0.01866694
p_int: 0.993094237
p_ni: 0.006901975
p_wrong: 0.000003788
Data Source: BioPlex
CNTNAP3B
Tdark
Novelty: 0.3692932
p_int: 0.991812053
p_ni: 0.008098233
p_wrong: 0.000089715
Data Source: BioPlex
USP22
Tbio
Family: Enzyme
Novelty: 0.01728935
p_int: 0.987616148
p_ni: 0.012370991
p_wrong: 0.000012861
Data Source: BioPlex
Publication Statistics
PubMed Score  659.52

PubMed score by year
PubTator Score  515.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP
1-70
WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD
70-140
FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS
140-210
SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR
210-280
VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
280-333
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP