You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TCF21
Transcription factor 21

Protein Summary
Description
Involved in epithelial-mesenchymal interactions in kidney and lung morphogenesis that include epithelial differentiation and branching morphogenesis. May play a role in the specification or differentiation of one or more subsets of epicardial cell types. TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000237316
  • ENSP00000237316
  • ENSG00000118526
  • ENST00000367882
  • ENSP00000356857

Symbol
  • BHLHA23
  • POD1
  • POD1
  • bHLHa23
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.94
molecular function
0.91
PubMedID
0.87
gene perturbation
0.8
tissue sample
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 882.18   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 138   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 882.18   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 138   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (35)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (71)
1 – 10 of 71
TBX18
Tbio
Family: TF
Novelty: 0.01534395
Score: 0.874
Data Source: STRINGDB
WT1
Tbio
Family: TF
Novelty: 0.00042049
Score: 0.846
Data Source: STRINGDB
CORO7
Tbio
Novelty: 0.21461421
Score: 0.805
Data Source: STRINGDB
TCF3
Tbio
Family: TF
Novelty: 0.00154157
Score: 0.766
Data Source: STRINGDB
NKX3-2
Tbio
Family: TF
Novelty: 0.02218518
Score: 0.73
Data Source: STRINGDB
EYA4
Tbio
Novelty: 0.02202971
Score: 0.725
Data Source: STRINGDB
TCF12
Tbio
Family: TF
Novelty: 0.00546341
Score: 0.663
Data Source: STRINGDB
GATAD1
Tbio
Family: TF
Novelty: 0.12711864
Score: 0.651
Data Source: STRINGDB
TLX1
Tbio
Family: TF
Novelty: 0.00747236
Score: 0.635
Data Source: STRINGDB
ALDH1A2
Tbio
Family: Enzyme
Novelty: 0.00544461
Score: 0.634
Data Source: STRINGDB
Publication Statistics
PubMed Score  882.18

PubMed score by year
PubTator Score  65.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS
1-70
GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY
70-140
ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
140-179
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS