You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TBX19
T-box transcription factor TBX19

Protein Summary
Description
Transcriptional regulator involved in developmental processes. Can activate POMC gene expression and repress the alpha glycoprotein subunit and thyroid-stimulating hormone beta promoters. This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367821
  • ENSP00000356795
  • ENSG00000143178

Symbol
  • TPIT
  • TPIT
  • TBS19
  • dJ747L4.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
cell type or tissue
0.67
biological process
0.6
protein domain
0.58
small molecule perturbation
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.37   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 124   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.37   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 124   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (111)
Items per page:
1 – 5 of 111
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Corticotropin-releasing hormone signaling pathway
WikiPathways
Corticotropin-releasing hormone signaling pathway
WikiPathways
Corticotropin-releasing hormone signaling pathway
WikiPathways
Corticotropin-releasing hormone signaling pathway
WikiPathways
Corticotropin-releasing hormone signaling pathway
Name
Explore in Pharos
Explore in Source
Corticotropin-releasing hormone signaling pathway
Corticotropin-releasing hormone signaling pathway
Corticotropin-releasing hormone signaling pathway
Corticotropin-releasing hormone signaling pathway
Corticotropin-releasing hormone signaling pathway
Gene Ontology Terms (11)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (38)
1 – 10 of 38
POMC
Tbio
Novelty: 0.00002654
Score: 0.945
Data Source: STRINGDB
POU1F1
Tbio
Family: TF
Novelty: 0.00581374
Score: 0.847
Data Source: STRINGDB
LHX3
Tbio
Family: TF
Novelty: 0.00952729
Score: 0.814
Data Source: STRINGDB
PITX1
Tbio
Family: TF
Novelty: 0.00292249
Score: 0.813
Data Source: STRINGDB
HESX1
Tbio
Family: TF
Novelty: 0.00773872
Score: 0.803
Data Source: STRINGDB
LHX4
Tbio
Family: TF
Novelty: 0.02376301
Score: 0.791
Data Source: STRINGDB
NR5A1
Tchem
Family: NR
Novelty: 0.00114781
Score: 0.77
Data Source: STRINGDB
PROP1
Tbio
Family: TF
Novelty: 0.00624823
Score: 0.696
Data Source: STRINGDB
TSHB
Tbio
Novelty: 0.00212016
Score: 0.695
Data Source: STRINGDB
GHRHR
Tclin
Family: GPCR
Novelty: 0.00767412
Score: 0.683
Data Source: STRINGDB
Publication Statistics
PubMed Score  46.37

PubMed score by year
PubTator Score  35.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRM
1-70
FPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPI
70-140
SFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYN
140-210
PFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCE
210-280
HYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGP
280-350
SPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST
350-420
WTAVASHPFAGWGGPGAGGHHSPSSLDG
420-448
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG