You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FASLG
Tumor necrosis factor ligand superfamily member 6

Protein Summary
Description
Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells (PubMed:26334989, PubMed:9228058). Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development (PubMed:9228058, PubMed:7528780, PubMed:9427603). Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses (By similarity). TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance (By similarity). Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis (PubMed:27806260). Tumor necrosis factor ligand superfamily member 6, soluble form: Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways (By similarity). Can induce apoptosis but does not appear to be essential for this process (PubMed:27806260). FasL intracellular domain: Cytoplasmic form induces gene transcription inhibition. This ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340030
  • ENSP00000344739
  • ENSG00000117560
  • ENST00000367721
  • ENSP00000356694

Symbol
  • APT1LG1
  • CD95L
  • FASL
  • TNFSF6
  • APTL
  • FASL
  • CD178
  • CD95L
  • ALPS1B
  • CD95-L
  • TNFSF6
  • TNLG1A
  • APT1LG1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
biological process
0.99
chemical
0.99
hub protein
0.88
cellular component
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2950.65   (req: < 5)
Gene RIFs: 505   (req: <= 3)
Antibodies: 1202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2950.65   (req: >= 5)
Gene RIFs: 505   (req: > 3)
Antibodies: 1202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 33
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (85)
Apoptosis (R-HSA-109581)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 25
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Apoptosis
Reactome
CASP8 activity is inhibited
Reactome
Caspase activation via Death Receptors in the presence of ligand
Reactome
Caspase activation via extrinsic apoptotic signalling pathway
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Apoptosis
CASP8 activity is inhibited
Caspase activation via Death Receptors in the presence of ligand
Caspase activation via extrinsic apoptotic signalling pathway
Cytokine Signaling in Immune system
Protein-Protein Interactions (256)
1 – 10 of 256
PRMT2
Tbio
Family: Epigenetic
Novelty: 0.05650489
p_int: 0.999999368
p_ni: 5.05e-7
p_wrong: 1.26e-7
Score: 0.167
Data Source: BioPlex,STRINGDB
EIF2AK1
Tchem
Family: Kinase
Novelty: 0.00602934
p_int: 0.999994839
p_ni: 1.85e-7
p_wrong: 0.000004975
Score: 0.416
Data Source: BioPlex,STRINGDB
SNX33
Tbio
Novelty: 0.3156708
p_int: 0.999986017
p_ni: 0.00001391
p_wrong: 7.3e-8
Score: 0.513
Data Source: BioPlex,STRINGDB
MOSPD2
Tbio
Novelty: 0.27833002
p_int: 0.991084962
p_ni: 0.00891495
p_wrong: 8.7e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
P3H3
Tbio
Family: Enzyme
Novelty: 0.00153717
p_int: 0.804819742
p_ni: 0.195180244
p_wrong: 1.4e-8
Score: 0.195
Data Source: BioPlex,STRINGDB
FADD
Tbio
Novelty: 0.00183502
Score: 0.998
Data Source: Reactome,STRINGDB
CASP8
Tchem
Family: Enzyme
Novelty: 0.00026844
Score: 0.998
Data Source: Reactome,STRINGDB
FAS
Tbio
Novelty: 0.00049744
Score: 0.998
Data Source: Reactome,STRINGDB
TNFRSF10B
Tbio
Novelty: 0.0006573
Score: 0.984
Data Source: STRINGDB
BID
Tbio
Novelty: 0.01362871
Score: 0.983
Data Source: STRINGDB
Publication Statistics
PubMed Score  2950.65

PubMed score by year
PubTator Score  3074.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP
1-70
LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEK
70-140
KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHK
140-210
VYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK
210-280
L
280-281
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL