You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BRINP3
BMP/retinoic acid-inducible neural-specific protein 3

Protein Summary
Description
Inhibits neuronal cell proliferation by negative regulation of the cell cycle transition. Promotes pituitary gonadotrope cell proliferation, migration and invasion, when overexpressed. May play a role in cell pituitary tumor development. This gene is overexpressed in pituitary tumors but is underexpressed in tongue squamous cell carcinomas, ulcerative colitis, and peri-implantitis. Polymorphisms that increase expression of this gene have been shown to increase vascular inflammation, and an association of this gene with myocardial infarction has been demonstrated. Finally, hypermethylation of this gene may find usefulness as a biomarker for gastric cancer. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367462
  • ENSP00000356432
  • ENSG00000162670

Symbol
  • DBCCR1L
  • DBCCR1L1
  • FAM5C
  • FAM5C
  • DBCCR1L
  • DBCCR1L1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.93
co-expressed gene
0.82
cell type or tissue
0.8
cell line
0.53
disease
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.36   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 81   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.36   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 81   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (51)
1 – 10 of 51
STIM2
Tbio
Novelty: 0.01143334
p_int: 0.999998394
p_ni: 0.000001606
Data Source: BioPlex
BRINP2
Tdark
Novelty: 1.14049587
p_int: 0.99991186
p_ni: 0.00008814
Score: 0.849
Data Source: BioPlex,STRINGDB
DHFR2
Tbio
Family: Enzyme
Novelty: 0.03421403
p_int: 0.997153558
p_ni: 0.002830615
p_wrong: 0.000015827
Data Source: BioPlex
TXNDC15
Tbio
Novelty: 0.0004225
p_int: 0.98664288
p_ni: 0.01335712
Data Source: BioPlex
BUB1
Tchem
Family: Kinase
Novelty: 0.0040442
p_int: 0.979147223
p_ni: 0.020852543
p_wrong: 2.33e-7
Data Source: BioPlex
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.976358573
p_ni: 0.023641427
Data Source: BioPlex
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.972499567
p_ni: 0.019636542
p_wrong: 0.007863892
Data Source: BioPlex
KIAA0232
Tdark
Novelty: 2
p_int: 0.953478941
p_ni: 0.046502736
p_wrong: 0.000018323
Data Source: BioPlex
TUBA1A
Tchem
Novelty: 0.0159455
p_int: 0.946278909
p_ni: 0.053721091
Data Source: BioPlex
CBWD1
Tbio
Novelty: 0.04454343
p_int: 0.944401219
p_ni: 0.055598781
Data Source: BioPlex
Publication Statistics
PubMed Score  14.36

PubMed score by year
PubTator Score  12.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQG
1-70
FSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSAT
70-140
LGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQLAASYFIDRDSTLRRLHHIQIASTAIKVTET
140-210
RTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWC
210-280
HCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSN
280-350
FQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS
350-420
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFET
420-490
DLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLT
490-560
KNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLR
560-630
SRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSAL
630-700
LQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS
700-766
MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQLAASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWCHCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLTKNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS