You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CFHR2
Complement factor H-related protein 2

Protein Summary
Description
Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH. Can associate with lipoproteins and may play a role in lipid metabolism. This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367415
  • ENSP00000356385
  • ENSG00000080910

Symbol
  • CFHL2
  • FHR2
  • HFL3
  • FHR2
  • HFL3
  • CFHL2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.85
cell line
0.49
disease
0.48
gene perturbation
0.48
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.16   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 117   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.16   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 117   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Regulation of Complement cascade
Name
Explore in Pharos
Explore in Source
Complement cascade
Immune System
Innate Immune System
Regulation of Complement cascade
Protein-Protein Interactions (28)
1 – 10 of 28
CFHR1
Tbio
Novelty: 0.00805757
p_int: 0.999999994
p_wrong: 6e-9
Score: 0.879
Data Source: BioPlex,STRINGDB
CFH
Tbio
Novelty: 0.0006078
Score: 0.948
Data Source: STRINGDB
C3
Tbio
Novelty: 0.00025052
Score: 0.777
Data Source: Reactome,STRINGDB
F9
Tchem
Family: Enzyme
Novelty: 0.00032545
Score: 0.728
Data Source: STRINGDB
ZBTB41
Tdark
Family: TF
Novelty: 4.23529412
Score: 0.611
Data Source: STRINGDB
CFI
Tbio
Novelty: 0.00194994
Score: 0.567
Data Source: STRINGDB
RBMS2
Tbio
Novelty: 0.03165193
Score: 0.559
Data Source: STRINGDB
CFB
Tchem
Novelty: 0.00128742
Score: 0.553
Data Source: STRINGDB
PGLYRP2
Tbio
Family: Enzyme
Novelty: 0.02505257
Score: 0.547
Data Source: STRINGDB
MYBPH
Tbio
Novelty: 0.00272812
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.16

PubMed score by year
PubTator Score  11.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI
1-70
TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC
70-140
RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS
140-210
QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
210-270
MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK