You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PARP1
Poly [ADP-ribose] polymerase 1

Protein Summary
Description
Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks (PubMed:17177976, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:23230272). Mediates the poly(ADP-ribosyl)ation of APLF and CHFR (PubMed:17396150). Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. With EEF1A1 and TXK, forms a complex that acts as a T-helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production (PubMed:17177976). Required for PARP9 and DTX3L recruitment to DNA damage sites (PubMed:23230272). PARP1-dependent PARP9-DTX3L-mediated ubiquitinatio ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000366794
  • ENSP00000355759
  • ENSG00000143799

Symbol
  • ADPRT
  • PPOL
  • PARP
  • PPOL
  • ADPRT
  • ARTD1
  • ADPRT1
  • PARP-1
  • ADPRT 1
  • pADPRT-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
hub protein
1
interacting protein
1
biological process
0.99
disease perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2401.66   (req: < 5)
Gene RIFs: 682   (req: <= 3)
Antibodies: 1714   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2401.66   (req: >= 5)
Gene RIFs: 682   (req: > 3)
Antibodies: 1714   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 67
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2373
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Active Ligands (2373)
1 – 10 of 2373
CHEMBL1086580
chemical structure image
CHEMBL506871
chemical structure image
CHEMBL372303
chemical structure image
CHEMBL45245
chemical structure image
CHEMBL571285,CHEMBL1092691
chemical structure image
CHEMBL576423,CHEMBL1093900
chemical structure image
CHEMBL3907010
chemical structure image
CHEMBL3663650
chemical structure image
CHEMBL3577700
chemical structure image
Protein Data Bank (56)
1 – 5 of 56
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (58)
Base Excision Repair (R-HSA-73884)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 26
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Base Excision Repair
Reactome
DNA Damage Recognition in GG-NER
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
Downregulation of SMAD2/3:SMAD4 transcriptional activity
Name
Explore in Pharos
Explore in Source
Base Excision Repair
DNA Damage Recognition in GG-NER
DNA Double-Strand Break Repair
DNA Repair
Downregulation of SMAD2/3:SMAD4 transcriptional activity
Gene Ontology Terms (78)
Items per page:
10
1 – 10 of 16
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (429)
1 – 10 of 429
MACROD1
Tbio
Family: Enzyme
Novelty: 0.0451872
p_int: 0.999796769
p_ni: 0.000203231
Score: 0.853
Data Source: BioPlex,STRINGDB
XPC
Tbio
Novelty: 0.00902281
p_int: 0.994439765
p_ni: 0.005560235
Score: 0.983
Data Source: BioPlex,Reactome,STRINGDB
H2AFX
Tbio
Novelty: 0.00052244
p_int: 0.993682002
p_ni: 0.006317998
Score: 0.818
Data Source: BioPlex,STRINGDB
APLF
Tbio
Novelty: 0.01671154
p_int: 0.992988297
p_ni: 0.007011703
Score: 0.853
Data Source: BioPlex,STRINGDB
XRCC6
Tbio
Novelty: 0.0013086
p_int: 0.979686271
p_ni: 0.020313729
Score: 0.978
Data Source: BioPlex,STRINGDB
RPA2
Tbio
Novelty: 0.01534532
p_int: 0.975348638
p_ni: 0.024651362
Score: 0.987
Data Source: BioPlex,STRINGDB
SNRNP27
Tbio
Novelty: 0.00944493
p_int: 0.965243211
p_ni: 0.034756789
Data Source: BioPlex
HIST1H4A
Tbio
Novelty: 0.00536075
p_int: 0.96386576
p_ni: 0.03613424
Score: 0.546
Data Source: BioPlex,STRINGDB
CHD1L
Tbio
Family: Enzyme
Novelty: 0.00580143
p_int: 0.961069852
p_ni: 0.038930148
Score: 0.99
Data Source: BioPlex,Reactome,STRINGDB
HIST1H2BA
Tbio
Novelty: 0.03503778
p_int: 0.95065353
p_ni: 0.04934647
Score: 0.552
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2401.66

PubMed score by year
PubTator Score  5460.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVE
1-70
VDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLS
70-140
KKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKG
140-210
DEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAIL
210-280
DRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV
280-350
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
350-420
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPV
420-490
EVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLV
490-560
DIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKN
560-630
FTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK
630-700
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLD
700-770
IEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
770-840
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHT
840-910
SQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVN
910-980
DTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
980-1014
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW