You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DARS2
Aspartate--tRNA ligase, mitochondrial

Protein Summary
Description
The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). [provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361951
  • ENSP00000355086
  • ENSG00000117593
  • ENST00000649689
  • ENSP00000497569

Symbol
  • LBSL
  • ASPRS
  • MT-ASPRS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
molecular function
0.97
transcription factor binding site profile
0.96
histone modification site profile
0.92
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.6   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 140   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.6   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 140   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Mitochondrial tRNA aminoacylation
Reactome
Translation
Reactome
tRNA Aminoacylation
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Mitochondrial tRNA aminoacylation
Translation
tRNA Aminoacylation
Protein-Protein Interactions (160)
1 – 10 of 160
GAPDHS
Tbio
Family: Enzyme
Novelty: 0.01313187
p_int: 0.96317537
p_ni: 0.036824629
p_wrong: 1e-9
Score: 0.159
Data Source: BioPlex,STRINGDB
YBEY
Tdark
Family: Enzyme
Novelty: 0.05001786
p_int: 0.889482547
p_ni: 0.110517453
Score: 0.459
Data Source: BioPlex,STRINGDB
LAMP3
Tbio
Novelty: 0.02024311
p_int: 0.878324577
p_ni: 0.121675423
Data Source: BioPlex
MRPL12
Tbio
Novelty: 0.16043959
p_int: 0.874988231
p_ni: 0.125011769
Score: 0.464
Data Source: BioPlex,STRINGDB
HSPD1
Tbio
Novelty: 0.00026641
p_int: 0.811339032
p_ni: 0.188660968
Score: 0.268
Data Source: BioPlex,STRINGDB
EARS2
Tbio
Family: Enzyme
Novelty: 0.00399418
Score: 0.9
Data Source: STRINGDB
RARS2
Tbio
Family: Enzyme
Novelty: 0.01344299
Score: 0.893
Data Source: STRINGDB
DARS
Tbio
Family: Enzyme
Novelty: 0.01186323
Score: 0.88
Data Source: STRINGDB
YARS
Tchem
Family: Enzyme
Novelty: 0.00307755
Score: 0.873
Data Source: STRINGDB
GATB
Tbio
Family: Enzyme
Novelty: 0.0265185
Score: 0.872
Data Source: STRINGDB
Publication Statistics
PubMed Score  52.60

PubMed score by year
PubTator Score  68.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCG
1-70
WIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIE
70-140
IKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDI
140-210
ETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQ
210-280
IDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRN
280-350
TEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME
350-420
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPK
420-490
EENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKED
490-560
VKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
560-630
IRVSKPTDSKAERAH
630-645
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH