You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
DRD2
D(2) dopamine receptor

Protein Summary
Description
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000346454
  • ENSP00000278597
  • ENSG00000149295
  • ENST00000362072
  • ENSP00000354859
  • ENST00000538967
  • ENSP00000438215
  • ENST00000542968
  • ENSP00000442172

Symbol
  • D2R
  • D2DR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
chemical
1
drug
1
ligand (chemical)
1
molecular function
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3452.69   (req: < 5)
Gene RIFs: 821   (req: <= 3)
Antibodies: 337   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3452.69   (req: >= 5)
Gene RIFs: 821   (req: > 3)
Antibodies: 337   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 103
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2365
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 79
Approved Drugs (79)
1 – 10 of 79
clozapine
chemical structure image
haloperidol
chemical structure image
olanzapine
chemical structure image
risperidone
chemical structure image
aripiprazole
chemical structure image
chlorpromazine
chemical structure image
ziprasidone
chemical structure image
dopamine
chemical structure image
sulpiride
chemical structure image
spiperone
chemical structure image
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (39)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Dopamine receptors
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
Dopamine receptors
G alpha (i) signalling events
GPCR downstream signalling
Gene Ontology Terms (123)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (452)
1 – 10 of 452
MSRA
Tbio
Family: Enzyme
Novelty: 0.00941816
p_int: 0.999998758
p_ni: 1e-8
p_wrong: 0.000001232
Score: 0.397
Data Source: BioPlex,STRINGDB
COLEC12
Tbio
Novelty: 0.00845079
p_int: 0.977532225
p_ni: 0.022467763
p_wrong: 1.2e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
WDR45
Tbio
Novelty: 0.02244727
p_int: 0.958364201
p_ni: 0.040451262
p_wrong: 0.001184537
Score: 0.199
Data Source: BioPlex,STRINGDB
NDFIP1
Tbio
Novelty: 0.05005263
p_int: 0.804954611
p_ni: 0.195044898
p_wrong: 4.91e-7
Score: 0.193
Data Source: BioPlex,STRINGDB
SLC6A3
Tclin
Family: Transporter
Novelty: 0.00024052
Score: 0.99
Data Source: STRINGDB
CNR1
Tclin
Family: GPCR
Novelty: 0.00017618
Score: 0.984
Data Source: STRINGDB
NCS1
Tbio
Novelty: 0.00364462
Score: 0.977
Data Source: STRINGDB
GRK2
Tchem
Family: Kinase
Novelty: 0.00230753
Score: 0.974
Data Source: STRINGDB
PENK
Tbio
Novelty: 0.00085036
Score: 0.969
Data Source: STRINGDB
PDYN
Tbio
Novelty: 0.00033852
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  3452.69

PubMed score by year
PubTator Score  2969.27

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTN
1-70
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPM
70-140
LYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYI
140-210
KIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELE
210-280
MEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGK
280-350
TRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
350-420
VNPIIYTTFNIEFRKAFLKILHC
420-443
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC