You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OPA1
Dynamin-like 120 kDa protein, mitochondrial

Protein Summary
Description
Dynamin-related GTPase that is essential for normal mitochondrial morphology by regulating the equilibrium between mitochondrial fusion and mitochondrial fission (PubMed:16778770, PubMed:17709429, PubMed:20185555, PubMed:24616225, PubMed:28746876). Coexpression of isoform 1 with shorter alternative products is required for optimal activity in promoting mitochondrial fusion (PubMed:17709429). Binds lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and promotes membrane tubulation (PubMed:20185555). The intrinsic GTPase activity is low, and is strongly increased by interaction with lipid membranes (PubMed:20185555). Plays a role in remodeling cristae and the release of cytochrome c during apoptosis (By similarity). Proteolytic processing in response to intrinsic apoptotic signals may lead to disassembly of OPA1 oligomers and release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space (By similarity). Plays a role in mit ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361150
  • ENSP00000354781
  • ENSG00000198836
  • ENST00000361510
  • ENSP00000355324
  • ENST00000361828
  • ENSP00000354429
  • ENST00000361908
  • ENSP00000354681
  • ENST00000392437
  • ENSP00000376232
  • ENST00000392438
  • ENSP00000376233
  • ENST00000646793
  • ENSP00000494512

Symbol
  • KIAA0567
  • NPG
  • NTG
  • MGM1
  • BERHS
  • largeG
  • MTDPS14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.96
molecular function
0.95
biological term
0.9
virus perturbation
0.9
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 435.11   (req: < 5)
Gene RIFs: 179   (req: <= 3)
Antibodies: 270   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 435.11   (req: >= 5)
Gene RIFs: 179   (req: > 3)
Antibodies: 270   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 39
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Apoptosis (R-HSA-109581)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Apoptosis
Reactome
Programmed Cell Death
Reactome
Regulation of Apoptosis
Name
Explore in Pharos
Explore in Source
Apoptosis
Programmed Cell Death
Regulation of Apoptosis
Gene Ontology Terms (53)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (123)
1 – 10 of 123
CHCHD4
Tbio
Novelty: 0.01246396
p_int: 0.999256891
p_ni: 0.000743109
Score: 0.378
Data Source: BioPlex,STRINGDB
SCGN
Tbio
Novelty: 0.01547867
p_int: 0.998570777
p_ni: 0.001429223
Score: 0.202
Data Source: BioPlex,STRINGDB
PRDX3
Tbio
Family: Enzyme
Novelty: 0.00452612
p_int: 0.998093556
p_ni: 0.001906445
Score: 0.628
Data Source: BioPlex,STRINGDB
SCN2B
Tbio
Family: IC
Novelty: 0.04179386
p_int: 0.996303586
p_ni: 0.003696413
p_wrong: 1e-9
Data Source: BioPlex
VIPR2
Tchem
Family: GPCR
Novelty: 0.00602252
p_int: 0.973592633
p_ni: 0.026407367
Data Source: BioPlex
INSYN2
Tdark
p_int: 0.88861023
p_ni: 0.11138977
Score: 0.153
Data Source: BioPlex,STRINGDB
NPY2R
Tchem
Family: GPCR
Novelty: 0.01163073
p_int: 0.884394607
p_ni: 0.115605393
Data Source: BioPlex
PTH1R
Tclin
Family: GPCR
Novelty: 0.0018948
p_int: 0.820661349
p_ni: 0.179338649
p_wrong: 1e-9
Score: 0.321
Data Source: BioPlex,STRINGDB
CMKLR1
Tchem
Family: GPCR
Novelty: 0.00748603
p_int: 0.815838112
p_ni: 0.184161888
Data Source: BioPlex
FAM174A
Tdark
Novelty: 0.44599913
p_int: 0.792389089
p_ni: 0.207610911
Data Source: BioPlex
Publication Statistics
PubMed Score  435.11

PubMed score by year
PubTator Score  428.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPL
1-70
RKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFDQWKDMIPDLSEYKWIVPDIV
70-140
WEIDEYIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKVS
140-210
DKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDA
210-280
SYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDL
280-350
TKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFS
350-420
ISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKL
420-490
FPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESV
490-560
EQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVST
560-630
HVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKL
630-700
KEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPD
700-770
WKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQV
770-840
YRRHFLKTALNHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNV
840-910
KEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
910-960
MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFDQWKDMIPDLSEYKWIVPDIVWEIDEYIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK