You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PPT2
Lysosomal thioesterase PPT2

Protein Classes
Protein Summary
Description
Removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA. Has the highest S-thioesterase activity for the acyl groups palmitic and myristic acid followed by other short- and long-chain acyl substrates. However, because of structural constraints, is unable to remove palmitate from peptides or proteins. This gene encodes a member of the palmitoyl-protein thioesterase family. The encoded glycosylated lysosomal protein has palmitoyl-CoA hydrolase activity in vitro, but does not hydrolyze palmitate from cysteine residues in proteins. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream EGFL8 (EGF-like-domain, multiple 8) gene. [provided by RefSeq, Feb 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324816
  • ENSP00000320528
  • ENSG00000221988
  • ENST00000361568
  • ENSP00000354608
  • ENST00000375137
  • ENSP00000364279
  • ENST00000375143
  • ENSP00000364285
  • ENST00000383301
  • ENSP00000372789
  • ENSG00000206329
  • ENST00000395523
  • ENSP00000378894
  • ENST00000412651
  • ENSP00000416505
  • ENSG00000236649
  • ENST00000414356
  • ENSP00000398462
  • ENSG00000168452
  • ENST00000415972
  • ENSP00000408333
  • ENSG00000228116
  • ENST00000423347
  • ENSP00000406219
  • ENSG00000231618
  • ENST00000433748
  • ENSP00000410001
  • ENSG00000206256
  • ENST00000476214
  • ENSP00000432308
  • ENST00000480383
  • ENSP00000432502
  • ENST00000483565
  • ENSP00000431928
  • ENST00000488579
  • ENSP00000434992
  • ENST00000490624
  • ENSP00000433323
  • ENST00000493809
  • ENSP00000436963
  • ENSG00000227600
  • ENST00000496937
  • ENSP00000432964
  • ENST00000527704
  • ENSP00000433061

Symbol
  • G14
  • PPT-2
  • C6orf8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
virus perturbation
0.68
phenotype
0.66
cell line
0.61
cellular component
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 131.62   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 117   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 131.62   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 117   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Fatty acyl-CoA biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Fatty acyl-CoA biosynthesis
Metabolism
Metabolism of lipids
Protein-Protein Interactions (98)
1 – 10 of 98
UST
Tbio
Family: Enzyme
Novelty: 0.00328192
p_int: 0.994423012
p_ni: 0.005576988
Score: 0.175
Data Source: BioPlex,STRINGDB
ZNF232
Tdark
Family: TF
Novelty: 0.91666667
p_int: 0.991770067
p_ni: 0.008229131
p_wrong: 8.02e-7
Score: 0.158
Data Source: BioPlex,STRINGDB
NAXD
Tdark
Family: Enzyme
Novelty: 0.20689655
p_int: 0.942459563
p_ni: 0.057436555
p_wrong: 0.000103882
Score: 0.223
Data Source: BioPlex,STRINGDB
IDS
Tbio
Family: Enzyme
Novelty: 0.0090788
p_int: 0.9366092
p_ni: 0.063390781
p_wrong: 1.9e-8
Score: 0.181
Data Source: BioPlex,STRINGDB
LYZL1
Tdark
Family: Enzyme
Novelty: 0.21384929
p_int: 0.935185128
p_ni: 0.064720577
p_wrong: 0.000094295
Data Source: BioPlex
DHFR2
Tbio
Family: Enzyme
Novelty: 0.03421403
p_int: 0.920226005
p_ni: 0.079544606
p_wrong: 0.000229388
Data Source: BioPlex
LYPD4
Tbio
Novelty: 0.00522455
p_int: 0.919728376
p_ni: 0.08018225
p_wrong: 0.000089373
Data Source: BioPlex
CMA1
Tchem
Family: Enzyme
Novelty: 0.00089798
p_int: 0.907069029
p_ni: 0.092272448
p_wrong: 0.000658523
Data Source: BioPlex
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.882968676
p_ni: 0.117031176
p_wrong: 1.48e-7
Data Source: BioPlex
FBXO6
Tbio
Novelty: 0.05038914
p_int: 0.844951915
p_ni: 0.15499703
p_wrong: 0.000051056
Score: 0.169
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  131.62

PubMed score by year
PubTator Score  53.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTV
1-70
LDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQM
70-140
GQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVW
140-210
RKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAG
210-280
ISHTAWHSNRTLYETCIEPWLS
280-302
MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS