You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PHETA1
Sesquipedalian-1

Protein Summary
Description
Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane. This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361483
  • ENSP00000354461
  • ENSG00000198324
  • ENST00000547838
  • ENSP00000447353
  • ENST00000548163
  • ENSP00000449994

Symbol
  • FAM109A
  • SES1
  • FAM109A
  • IPIP27A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
cell type or tissue
0.73
virus perturbation
0.64
cellular component
0.63
cell line
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.17   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 72   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.17   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 72   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (33)
1 – 10 of 33
INPP5B
Tbio
Family: Enzyme
Novelty: 0.03037186
p_int: 0.99999996
p_ni: 3.8e-8
p_wrong: 1e-9
Score: 0.967
Data Source: BioPlex,STRINGDB
CARD9
Tbio
Family: Enzyme
Novelty: 0.00825918
p_int: 0.999999357
p_ni: 6.43e-7
Score: 0.251
Data Source: BioPlex,STRINGDB
PLEKHJ1
Tdark
Novelty: 4
p_int: 0.99999413
p_ni: 1.2e-7
p_wrong: 0.000005751
Score: 0.933
Data Source: BioPlex,STRINGDB
OCRL
Tbio
Family: Enzyme
Novelty: 0.0058211
p_int: 0.999988829
p_ni: 0.000011171
Score: 0.995
Data Source: BioPlex,STRINGDB
GPX7
Tbio
Family: Enzyme
Novelty: 0.02063033
p_int: 0.998449137
p_ni: 0.000006646
p_wrong: 0.001544217
Score: 0.537
Data Source: BioPlex,STRINGDB
SPG7
Tbio
Family: Enzyme
Novelty: 0.00141214
p_int: 0.947207147
p_ni: 0.052792853
p_wrong: 1e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
PHETA2
Tbio
Novelty: 8
Score: 0.793
Data Source: STRINGDB
CUX2
Tbio
Family: TF
Novelty: 0.01784951
Score: 0.64
Data Source: STRINGDB
TSPEAR
Tbio
Novelty: 0.26979678
Score: 0.623
Data Source: STRINGDB
TMEM116
Tdark
Novelty: 10
Score: 0.576
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.17

PubMed score by year
PubTator Score  0.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVEL
1-70
VEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQ
70-140
PQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRR
140-210
RASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
210-249
MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP