You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
NTRK3
NT-3 growth factor receptor

Protein Summary
Description
Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation. This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000317501
  • ENSP00000318328
  • ENSG00000140538
  • ENST00000355254
  • ENSP00000347397
  • ENST00000357724
  • ENSP00000350356
  • ENST00000360948
  • ENSP00000354207
  • ENST00000394480
  • ENSP00000377990
  • ENST00000540489
  • ENSP00000444673
  • ENST00000557856
  • ENSP00000453959
  • ENST00000629765
  • ENSP00000485864

Symbol
  • TRKC
  • TRKC
  • GP145-TrkC
  • gp145(trkC)
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
protein domain
1
molecular function
0.99
microRNA
0.86
PubMedID
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 365.08   (req: < 5)
Gene RIFs: 98   (req: <= 3)
Antibodies: 696   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 365.08   (req: >= 5)
Gene RIFs: 98   (req: > 3)
Antibodies: 696   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 46
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 28
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
Activated NTRK3 signals through PI3K (R-HSA-9603381)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated NTRK3 signals through PI3K
Reactome
Activated NTRK3 signals through PLCG1
Reactome
Activated NTRK3 signals through RAS
Reactome
NTF3 activates NTRK3 signaling
Reactome
NTRK3 as a dependence receptor
Name
Explore in Pharos
Explore in Source
Activated NTRK3 signals through PI3K
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through RAS
NTF3 activates NTRK3 signaling
NTRK3 as a dependence receptor
Gene Ontology Terms (53)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (172)
1 – 10 of 172
SH3BP4
Tbio
Novelty: 0.1659751
p_int: 0.999989254
p_ni: 0.000004466
p_wrong: 0.000006281
Data Source: BioPlex
PTPRS
Tchem
Family: Enzyme
Novelty: 0.00616027
p_int: 0.999968839
p_ni: 0.000031159
p_wrong: 2e-9
Score: 0.959
Data Source: BioPlex,Reactome,STRINGDB
MYADM
Tbio
Novelty: 0.09214874
p_int: 0.999286754
p_ni: 0.000704051
p_wrong: 0.000009195
Data Source: BioPlex
C1GALT1
Tbio
Family: Enzyme
Novelty: 0.01514342
p_int: 0.996606785
p_ni: 0.002553248
p_wrong: 0.000839967
Score: 0.191
Data Source: BioPlex,STRINGDB
GNB2
Tbio
Novelty: 0.20536996
p_int: 0.994610679
p_ni: 0.005389321
p_wrong: 1e-9
Score: 0.18
Data Source: BioPlex,STRINGDB
C6orf120
Tdark
Novelty: 0.6440678
p_int: 0.987845041
p_ni: 0.012030619
p_wrong: 0.00012434
Data Source: BioPlex
MTOR
Tclin
Family: Kinase
Novelty: 0.00014431
p_int: 0.983867862
p_ni: 0.016132138
Score: 0.306
Data Source: BioPlex,STRINGDB
LGALS1
Tchem
Novelty: 0.00134398
p_int: 0.976227229
p_ni: 0.023772515
p_wrong: 2.56e-7
Data Source: BioPlex
PTCD2
Tdark
Novelty: 0.85714286
p_int: 0.961510215
p_ni: 0.038489784
Data Source: BioPlex
TMEM11
Tbio
Novelty: 0.00132758
p_int: 0.956495789
p_ni: 0.023022626
p_wrong: 0.020481585
Data Source: BioPlex
Publication Statistics
PubMed Score  365.08

PubMed score by year
PubTator Score  282.96

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS
1-70
INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT
70-140
TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP
140-210
EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF
210-280
TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV
280-350
EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
350-420
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT
420-490
PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL
490-560
SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR
560-630
AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM
630-700
SRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQP
700-770
WFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
770-839
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG