You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AGBL5
Cytosolic carboxypeptidase-like protein 5

Protein Summary
Description
Metallocarboxypeptidase that mediates protein deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins. In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains, a process catalyzed by AGTPBP1/CCP1, AGBL2/CCP2, AGBL3/CCP3, AGBL1/CCP4 and AGBL4/CCP6. Mediates deglutamylation of CGAS, regulating the antiviral activity of CGAS. This gene encodes a metallocarboxypeptidase involved in protein deglutamylation and a member of the peptidase M14 family of proteins. The encoded protein has been described as a "dual-functional" deglutamylase that can remove glutamate residues from both carboxyl termini and side chains of protein substrates. This deglutamylase activity may be important in antiviral immunity. Mutations in this gene are associated with retinitis pigmentosa. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000323064
  • ENSP00000323681
  • ENSG00000084693
  • ENST00000360131
  • ENSP00000353249
  • ENST00000487078
  • ENSP00000433830

Symbol
  • CCP5
  • CCP5
  • RP75
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.91
histone modification site profile
0.83
kinase perturbation
0.81
transcription factor perturbation
0.8
virus perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.96   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 148   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.96   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 148   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Carboxyterminal post-translational modifications of tubulin (R-HSA-8955332)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Carboxyterminal post-translational modifications of tubulin
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Carboxyterminal post-translational modifications of tubulin
Metabolism of proteins
Post-translational protein modification
Gene Ontology Terms (13)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (37)
1 – 10 of 37
TPCN2
Tchem
Family: IC
Novelty: 0.01836974
p_int: 0.999997229
p_ni: 0.000002771
Data Source: BioPlex
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.999878422
p_ni: 0.000121551
p_wrong: 2.7e-8
Data Source: BioPlex
RELL2
Tbio
Novelty: 0.65217391
p_int: 0.999852607
p_ni: 0.000146216
p_wrong: 0.000001177
Score: 0.189
Data Source: BioPlex,STRINGDB
GFOD1
Tdark
Family: Enzyme
Novelty: 0.67708333
p_int: 0.993786703
p_ni: 0.006211955
p_wrong: 0.000001341
Score: 0.209
Data Source: BioPlex,STRINGDB
IL20RA
Tbio
Novelty: 0.03295383
p_int: 0.861817817
p_ni: 0.00093798
p_wrong: 0.137244203
Score: 0.175
Data Source: BioPlex,STRINGDB
EIF4G3
Tbio
Novelty: 0.04202311
Score: 0.69
Data Source: STRINGDB
DEAF1
Tbio
Family: TF
Novelty: 0.01643868
Score: 0.682
Data Source: STRINGDB
TTLL6
Tdark
Family: Enzyme
Novelty: 0.20537897
Score: 0.666
Data Source: STRINGDB
EVA1A
Tbio
Novelty: 0.02746635
Score: 0.651
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.636
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.96

PubMed score by year
PubTator Score  10.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRPDCAETEFENG
1-70
NRSWFYFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWERIRDRPTFEMTETQFVLSFV
70-140
HRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTI
140-210
TSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTL
210-280
RRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEH
280-350
QPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDTI
350-420
PPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRR
420-490
DGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGR
490-560
AMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVS
560-630
CSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRS
630-700
QDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGL
700-770
LGTGARMPCIKTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSCSATPGLPQARPPRPR
770-840
SAPAFSPISCSLSDSPSWNCYSRGPLGQPEVCFVPKSPPLTVSPRV
840-886
MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRPDCAETEFENGNRSWFYFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWERIRDRPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEHQPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRSQDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGLLGTGARMPCIKTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSCSATPGLPQARPPRPRSAPAFSPISCSLSDSPSWNCYSRGPLGQPEVCFVPKSPPLTVSPRV