You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MFAP5
Microfibrillar-associated protein 5

Protein Summary
Description
May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (PubMed:8557636). This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359478
  • ENSP00000352455
  • ENSG00000197614
  • ENST00000396549
  • ENSP00000379798
  • ENST00000540087
  • ENSP00000440496

Symbol
  • MAGP2
  • AAT9
  • MP25
  • MAGP2
  • MAGP-2
  • MFAP-5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
small molecule perturbation
0.71
PubMedID
0.7
gene perturbation
0.67
transcription factor perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 39.84   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 204   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 39.84   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 204   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (134)
Elastic fibre formation (R-HSA-1566948)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Elastic fibre formation
Reactome
Extracellular matrix organization
Reactome
Molecules associated with elastic fibres
Name
Explore in Pharos
Explore in Source
Elastic fibre formation
Extracellular matrix organization
Molecules associated with elastic fibres
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Protein-Protein Interactions (91)
1 – 10 of 91
VWDE
Tdark
Novelty: 0.7751938
p_int: 0.999989699
p_ni: 0.000010301
Data Source: BioPlex
ASB3
Tdark
Novelty: 0.29666183
p_int: 0.99998791
p_ni: 0.000012023
p_wrong: 6.7e-8
Data Source: BioPlex
TRPC4AP
Tbio
Novelty: 0.00440674
p_int: 0.997793608
p_ni: 0.002204137
p_wrong: 0.000002255
Data Source: BioPlex
LOXL2
Tbio
Family: Enzyme
Novelty: 0.00498838
p_int: 0.99772418
p_ni: 0.002275428
p_wrong: 3.93e-7
Score: 0.907
Data Source: BioPlex,STRINGDB
GGPS1
Tchem
Family: Enzyme
Novelty: 0.00446019
p_int: 0.997307225
p_ni: 0.002692768
p_wrong: 7e-9
Data Source: BioPlex
EMILIN2
Tbio
Novelty: 0.25691347
p_int: 0.99715806
p_ni: 0.002841047
p_wrong: 8.93e-7
Data Source: BioPlex
PASK
Tbio
Family: Kinase
Novelty: 0.08196721
p_int: 0.993810971
p_ni: 0.006189029
Data Source: BioPlex
MANBA
Tchem
Family: Enzyme
Novelty: 0.00878537
p_int: 0.99210774
p_ni: 0.00789226
Data Source: BioPlex
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.988212327
p_ni: 0.011787673
Data Source: BioPlex
TUBB3
Tclin
Novelty: 0.00281462
p_int: 0.985563804
p_ni: 0.014436196
Data Source: BioPlex
Publication Statistics
PubMed Score  39.84

PubMed score by year
PubTator Score  43.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD
1-70
DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC
70-140
RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
140-173
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL