You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC2A10
Solute carrier family 2, facilitated glucose transporter member 10

Protein Summary
Description
Facilitative glucose transporter. This gene encodes a member of the class III facilitative glucose transporter family. The encoded protein plays a role in regulation of glucose homeostasis. Mutations in this gene have been associated with arterial tortuosity syndrome.[provided by RefSeq, Dec 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359271
  • ENSP00000352216
  • ENSG00000197496

Symbol
  • GLUT10
  • ATS
  • ATORS
  • GLUT10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.8
tissue sample
0.63
molecular function
0.6
protein domain
0.58
histone modification site profile
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.09   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 142   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.09   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 142   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Cellular hexose transport (R-HSA-189200)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular hexose transport
Reactome
Defective SLC2A10 causes arterial tortuosity syndrome (ATS)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
SLC transporter disorders
Name
Explore in Pharos
Explore in Source
Cellular hexose transport
Defective SLC2A10 causes arterial tortuosity syndrome (ATS)
Disease
Disorders of transmembrane transporters
SLC transporter disorders
Protein-Protein Interactions (48)
1 – 10 of 48
SRC
Tclin
Family: Kinase
Novelty: 0.00009742
p_int: 0.962835938
p_ni: 0.035103923
p_wrong: 0.002060139
Data Source: BioPlex
FBN1
Tbio
Novelty: 0.00083059
Score: 0.656
Data Source: STRINGDB
SLC16A10
Tbio
Family: Transporter
Novelty: 0.03767726
Score: 0.645
Data Source: STRINGDB
EFEMP2
Tbio
Novelty: 0.01932044
Score: 0.612
Data Source: STRINGDB
ACTA2
Tbio
Novelty: 0.00281551
Score: 0.597
Data Source: STRINGDB
MYH11
Tbio
Novelty: 0.00189652
Score: 0.596
Data Source: STRINGDB
SLC5A10
Tbio
Family: Transporter
Novelty: 0.16789926
Score: 0.595
Data Source: STRINGDB
TGFBR1
Tchem
Family: Kinase
Novelty: 0.00099344
Score: 0.565
Data Source: STRINGDB
COL3A1
Tbio
Novelty: 0.00231183
Score: 0.56
Data Source: STRINGDB
TGFBR2
Tchem
Family: Kinase
Novelty: 0.00128741
Score: 0.554
Data Source: STRINGDB
Publication Statistics
PubMed Score  28.09

PubMed score by year
PubTator Score  41.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLID
1-70
CYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYE
70-140
AGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLG
140-210
PGRPRYSFLDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVK
210-280
VAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQD
280-350
SSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
350-420
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGL
420-490
GFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS
490-541
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFVSAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS