You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TGFBR2
TGF-beta receptor type-2

Protein Summary
Description
Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295754
  • ENSP00000295754
  • ENSG00000163513
  • ENST00000359013
  • ENSP00000351905

Symbol
  • AAT3
  • FAA3
  • LDS2
  • MFS2
  • RIIC
  • LDS1B
  • LDS2B
  • TAAD2
  • TBRII
  • TBR-ii
  • TGFR-2
  • TGFbeta-RII
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
1
hub protein
0.99
PubMedID
0.98
transcription factor perturbation
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 776.68   (req: < 5)
Gene RIFs: 349   (req: <= 3)
Antibodies: 734   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 776.68   (req: >= 5)
Gene RIFs: 349   (req: > 3)
Antibodies: 734   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 84
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (13)
1 – 5 of 13
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (123)
Deubiquitination (R-HSA-5688426)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deubiquitination
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Downregulation of TGF-beta receptor signaling
Reactome
Loss of Function of SMAD2/3 in Cancer
Name
Explore in Pharos
Explore in Source
Deubiquitination
Disease
Diseases of signal transduction
Downregulation of TGF-beta receptor signaling
Loss of Function of SMAD2/3 in Cancer
Gene Ontology Terms (92)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (252)
1 – 10 of 252
FMN2
Tbio
Novelty: 0.01798553
p_int: 0.999778831
p_ni: 0.000219207
p_wrong: 0.000001962
Score: 0.233
Data Source: BioPlex,STRINGDB
ACVR2B
Tchem
Family: Kinase
Novelty: 0.00693595
p_int: 0.999678794
p_ni: 0.000314222
p_wrong: 0.000006985
Score: 0.189
Data Source: BioPlex,STRINGDB
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
p_int: 0.99953362
p_ni: 0.00046638
Score: 0.657
Data Source: BioPlex,STRINGDB
MYADM
Tbio
Novelty: 0.09214874
p_int: 0.999418203
p_ni: 0.000580601
p_wrong: 0.000001196
Data Source: BioPlex
DENND6A
Tbio
Novelty: 8
p_int: 0.998203843
p_ni: 0.001796156
p_wrong: 1e-9
Data Source: BioPlex
RELT
Tbio
Novelty: 0.01273037
p_int: 0.990789375
p_ni: 0.002299616
p_wrong: 0.006911009
Score: 0.226
Data Source: BioPlex,STRINGDB
RAB6B
Tbio
Family: Enzyme
Novelty: 0.07884363
p_int: 0.986593271
p_ni: 0.013406669
p_wrong: 6e-8
Data Source: BioPlex
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
p_int: 0.974123871
p_ni: 0.025876129
Score: 0.241
Data Source: BioPlex,STRINGDB
PLEKHH3
Tdark
Novelty: 3.52941176
p_int: 0.969212294
p_ni: 0.030787706
Score: 0.199
Data Source: BioPlex,STRINGDB
PIK3R1
Tchem
Family: Kinase
Novelty: 0.00286014
p_int: 0.944480495
p_ni: 0.055519505
Score: 0.676
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  776.68

PubMed score by year
PubTator Score  653.46

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSN
1-70
CSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS
70-140
DECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLM
140-210
EFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
210-280
YEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL
280-350
GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
350-420
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDN
420-490
VLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPED
490-560
GSLNTTK
560-567
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK