You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TMEM126B
Complex I assembly factor TMEM126B, mitochondrial

Protein Summary
Description
Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I. This gene encodes a mitochondrial transmembrane protein which is a component of the mitochondrial complex I assembly complex. The encoded protein serves as an assembly factor that is required for formation of the membrane arm of the complex. It interacts with NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 13. Naturally occurring mutations in this gene are associated with isolated complex I deficiency. A pseudogene of this gene has been defined on chromosome 9. [provided by RefSeq, Apr 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000358867
  • ENSP00000351737
  • ENSG00000171204
  • ENST00000393375
  • ENSP00000377039
  • ENST00000534341
  • ENSP00000433471

Symbol
  • HT007
  • MC1DN29
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.91
cell type or tissue
0.89
transcription factor binding site profile
0.81
disease perturbation
0.62
transcription factor
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.23   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 56   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.23   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 56   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Complex I biogenesis (R-HSA-6799198)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complex I biogenesis
Reactome
Metabolism
Reactome
Respiratory electron transport
Reactome
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Complex I biogenesis
Metabolism
Respiratory electron transport
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
The citric acid (TCA) cycle and respiratory electron transport
Protein-Protein Interactions (96)
1 – 10 of 96
NDUFAF4
Tclin
Family: Enzyme
Novelty: 0.18993352
p_int: 0.994432807
p_ni: 0.005567172
p_wrong: 2.2e-8
Score: 0.948
Data Source: BioPlex,STRINGDB
ECSIT
Tbio
Novelty: 0.06686583
p_int: 0.988096198
p_ni: 0.011903802
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
NDUFA13
Tclin
Family: Enzyme
Novelty: 0.01820177
p_int: 0.970297627
p_ni: 0.029702373
Score: 0.993
Data Source: BioPlex,STRINGDB
NDUFC2
Tclin
Family: Enzyme
Novelty: 0.16071429
p_int: 0.887774657
p_ni: 0.1122252
p_wrong: 1.43e-7
Score: 0.989
Data Source: BioPlex,STRINGDB
APLNR
Tchem
Family: GPCR
Novelty: 0.001441
p_int: 0.883608512
p_ni: 0.116391425
p_wrong: 6.3e-8
Data Source: BioPlex
NDUFS5
Tclin
Family: Enzyme
Novelty: 0.59900166
p_int: 0.836586209
p_ni: 0.163413656
p_wrong: 1.35e-7
Score: 0.906
Data Source: BioPlex,STRINGDB
GLMP
Tdark
Novelty: 0.08368201
p_int: 0.820352146
p_ni: 0.179647847
p_wrong: 7e-9
Data Source: BioPlex
PDCD1
Tclin
Novelty: 0.00079757
p_int: 0.814907641
p_ni: 0.185086296
p_wrong: 0.000006062
Data Source: BioPlex
NDUFB11
Tclin
Family: Enzyme
Novelty: 0.00598699
p_int: 0.791609913
p_ni: 0.208390087
Score: 0.951
Data Source: BioPlex,STRINGDB
NDUFAF1
Tclin
Novelty: 0.0776632
p_int: 0.788862947
p_ni: 0.211137053
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
Publication Statistics
PubMed Score  4.23

PubMed score by year
PubTator Score  3.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQ
1-70
NIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC
70-140
VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGIL
140-210
NGLYHYAVFEETLEKTIHEE
210-230
MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE