You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
NR3C2
Mineralocorticoid receptor

Protein Summary
Description
Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342437
  • ENSP00000343907
  • ENSG00000151623
  • ENST00000344721
  • ENSP00000341390
  • ENST00000358102
  • ENSP00000350815
  • ENST00000511528
  • ENSP00000421481
  • ENST00000512865
  • ENSP00000423510
  • ENST00000625323
  • ENSP00000486719

Symbol
  • MCR
  • MLR
  • MR
  • MCR
  • MLR
  • NR3C2VIT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
virus perturbation
0.9
microRNA
0.83
disease
0.82
molecular function
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1298.93   (req: < 5)
Gene RIFs: 172   (req: <= 3)
Antibodies: 267   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1298.93   (req: >= 5)
Gene RIFs: 172   (req: > 3)
Antibodies: 267   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 155
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 15
Protein Data Bank (25)
1 – 5 of 25
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Cellular responses to external stimuli (R-HSA-8953897)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Name
Explore in Pharos
Explore in Source
Cellular responses to external stimuli
Cellular responses to stress
Gene expression (Transcription)
Generic Transcription Pathway
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Gene Ontology Terms (12)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (142)
1 – 10 of 142
CARNMT1
Tbio
Family: Enzyme
Novelty: 0.3423913
p_int: 0.964682861
p_ni: 2e-9
p_wrong: 0.035317138
Score: 0.231
Data Source: BioPlex,STRINGDB
HSP90AA1
Tchem
Novelty: 0.00020424
Score: 0.967
Data Source: STRINGDB
FKBP4
Tchem
Family: Enzyme
Novelty: 0.00175302
Score: 0.965
Data Source: STRINGDB
FKBP5
Tchem
Family: Enzyme
Novelty: 0.00252437
Score: 0.96
Data Source: STRINGDB
UBE2I
Tbio
Novelty: 0.00316288
Score: 0.95
Data Source: Reactome,STRINGDB
SUMO1
Tbio
Novelty: 0.00169202
Score: 0.947
Data Source: Reactome,STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.945
Data Source: STRINGDB
NR3C1
Tclin
Family: NR
Novelty: 0.00034101
Score: 0.943
Data Source: STRINGDB
PIAS1
Tbio
Family: TF
Novelty: 0.01153358
Score: 0.941
Data Source: STRINGDB
HSP90AB1
Tchem
Novelty: 0.01466977
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score  1298.93

PubMed score by year
PubTator Score  1246.37

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNSTQGSSKEKQEL
1-70
LPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQL
70-140
VKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAVVKSPIMCHEKSPSVCSPLNMTSSVCSPAGI
140-210
NSVSSTTASFGSFPVHSPITQGTPLTCSPNVENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCS
210-280
VKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSA
280-350
GSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
350-420
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFP
420-490
VGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESW
490-560
KSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCKVFFKRA
560-630
VEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP
630-700
PQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLN
700-770
RLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
770-840
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKC
840-910
PNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLY
910-980
FHRK
980-984
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNSTQGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAVVKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPNVENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSDSSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK