You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NAT9
N-acetyltransferase 9

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357814
  • ENSP00000350467
  • ENSG00000109065
  • ENST00000580301
  • ENSP00000462019

Symbol
  • EBS
  • EBSP, hNATL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
histone modification site profile
0.85
tissue sample
0.7
transcription factor
0.65
tissue
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 281.44   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 66   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 281.44   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 66   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (52)
1 – 10 of 52
CHEK1
Tchem
Family: Kinase
Novelty: 0.00078041
p_int: 0.998469685
p_ni: 0.001530315
Score: 0.228
Data Source: BioPlex,STRINGDB
MPP6
Tbio
Novelty: 0.10295762
p_int: 0.996877938
p_ni: 0.003122062
Score: 0.345
Data Source: BioPlex,STRINGDB
FLII
Tbio
Novelty: 0.00350197
p_int: 0.805511943
p_ni: 0.194488057
Score: 0.272
Data Source: BioPlex,STRINGDB
TSTD2
Tdark
Family: Enzyme
Novelty: 4
Score: 0.737
Data Source: STRINGDB
PLEC
Tbio
Novelty: 0.00291676
Score: 0.724
Data Source: STRINGDB
NAA20
Tbio
Family: Enzyme
Novelty: 0.07790762
Score: 0.708
Data Source: STRINGDB
EEF1E1
Tbio
Novelty: 0.07766287
Score: 0.694
Data Source: STRINGDB
NAT14
Tbio
Family: Enzyme
Novelty: 0.1
Score: 0.688
Data Source: STRINGDB
C1QTNF2
Tdark
Novelty: 0.37393768
Score: 0.686
Data Source: STRINGDB
TMCC2
Tdark
Novelty: 0.26054591
Score: 0.68
Data Source: STRINGDB
Publication Statistics
PubMed Score  281.44

PubMed score by year
PubTator Score  3.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVL
1-70
DAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTK
70-140
FEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
140-207
MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC