You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MCTP2
Multiple C2 and transmembrane domain-containing protein 2

Protein Summary
Description
Might play a role in the development of cardiac outflow tract.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357742
  • ENSP00000350377
  • ENSG00000140563
  • ENST00000451018
  • ENSP00000395109
  • ENST00000456504
  • ENSP00000388887
  • ENST00000557742
  • ENSP00000454847
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.99
microRNA
0.74
cell type or tissue
0.72
transcription factor
0.65
transcription factor perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.73   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.73   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HGNC
Protein-Protein Interactions (22)
1 – 10 of 22
B3GALT1
Tbio
Family: Enzyme
Novelty: 0.18656867
Score: 0.652
Data Source: STRINGDB
ARRDC4
Tbio
Novelty: 0.21296047
Score: 0.585
Data Source: STRINGDB
SLC29A3
Tbio
Family: Transporter
Novelty: 0.00456471
Score: 0.577
Data Source: STRINGDB
CSPG4
Tbio
Novelty: 0.00426568
Score: 0.568
Data Source: STRINGDB
ARRDC3
Tbio
Novelty: 0.06803495
Score: 0.559
Data Source: STRINGDB
RGMA
Tbio
Novelty: 0.0034752
Score: 0.558
Data Source: STRINGDB
TMEM182
Tdark
Novelty: 0.45618366
Score: 0.557
Data Source: STRINGDB
CDK15
Tchem
Family: Kinase
Novelty: 3.88235294
Score: 0.512
Data Source: STRINGDB
ST6GAL2
Tbio
Family: Enzyme
Novelty: 0.02155369
Score: 0.501
Data Source: STRINGDB
CEMIP2
Tbio
Novelty: 0.0935128
Score: 0.5
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.73

PubMed score by year
PubTator Score  4.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDLDKPSVWGSLKQRTRPLLINLSKKKVKKNPSKPPDLRARHHLDRRLSLSVPDLLEAEALAPEGRPYSG
1-70
PQSSYTSVPSSLSTAGIFPKSSSSSLKQSEEELDWSQEEASHLHVVETDSEEAYASPAERRRVSSNGIFD
70-140
LQKTSLGGDAPEEPEKLCGSSDLNASMTSQHFEEQSVPGEASDGLSNLPSPFAYLLTIHLKEGRNLVVRD
140-210
RCGTSDPYVKFKLNGKTLYKSKVIYKNLNPVWDEIVVLPIQSLDQKLRVKVYDRDLTTSDFMGSAFVILS
210-280
DLELNRTTEHILKLEDPNSLEDDMGVIVLNLNLVVKQGDFKRHRWSNRKRLSASKSSLIRNLRLSESLKK
280-350
NQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQWQEQFDFHYFSDRMGILDIEV
350-420
WGKDNKKHEERLGTCKVDISALPLKQANCLELPLDSCLGALLMLVTLTPCAGVSVSDLCVCPLADLSERK
420-490
QITQRYCLQNSLKDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVF
490-560
TFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYNP
560-630
VKASIRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQWESTLRSTIAFAVFLIT
630-700
VWNFELYMIPLALLLIFVYNFIRPVKGKVSSIQDSQESTDIDDEEDEDDKESEKKGLIERIYMVQDIVST
700-770
VQNVLEEIASFGERIKNTFNWTVPFLSSLACLILAAATIILYFIPLRYIILIWGINKFTKKLRNPYSIDN
770-840
NELLDFLSRVPSDVQKVQYAELKLCSSHSPLRKKRSAL
840-878
MDLDKPSVWGSLKQRTRPLLINLSKKKVKKNPSKPPDLRARHHLDRRLSLSVPDLLEAEALAPEGRPYSGPQSSYTSVPSSLSTAGIFPKSSSSSLKQSEEELDWSQEEASHLHVVETDSEEAYASPAERRRVSSNGIFDLQKTSLGGDAPEEPEKLCGSSDLNASMTSQHFEEQSVPGEASDGLSNLPSPFAYLLTIHLKEGRNLVVRDRCGTSDPYVKFKLNGKTLYKSKVIYKNLNPVWDEIVVLPIQSLDQKLRVKVYDRDLTTSDFMGSAFVILSDLELNRTTEHILKLEDPNSLEDDMGVIVLNLNLVVKQGDFKRHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQWQEQFDFHYFSDRMGILDIEVWGKDNKKHEERLGTCKVDISALPLKQANCLELPLDSCLGALLMLVTLTPCAGVSVSDLCVCPLADLSERKQITQRYCLQNSLKDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYNPVKASIRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQWESTLRSTIAFAVFLITVWNFELYMIPLALLLIFVYNFIRPVKGKVSSIQDSQESTDIDDEEDEDDKESEKKGLIERIYMVQDIVSTVQNVLEEIASFGERIKNTFNWTVPFLSSLACLILAAATIILYFIPLRYIILIWGINKFTKKLRNPYSIDNNELLDFLSRVPSDVQKVQYAELKLCSSHSPLRKKRSAL