You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NEGR1
Neuronal growth regulator 1

Protein Summary
Description
May be involved in cell-adhesion. May function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306821
  • ENSP00000305938
  • ENSG00000172260
  • ENST00000357731
  • ENSP00000350364

Symbol
  • IGLON4
  • Ntra
  • KILON
  • IGLON4
  • DMML2433
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
microRNA
0.86
protein domain
0.73
transcription factor binding site profile
0.7
disease
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.21   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 182   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.21   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 182   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational modification: synthesis of GPI-anchored proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational modification: synthesis of GPI-anchored proteins
Post-translational protein modification
Protein-Protein Interactions (168)
1 – 10 of 168
GLMN
Tbio
Novelty: 0.01373749
p_int: 0.974753006
p_ni: 0.025246974
p_wrong: 2e-8
Data Source: BioPlex
GET4
Tbio
Novelty: 0.00182534
p_int: 0.800895729
p_ni: 0.199104271
Data Source: BioPlex
NTM
Tbio
Novelty: 0.01681974
Score: 0.954
Data Source: STRINGDB
LSAMP
Tbio
Novelty: 0.01919048
Score: 0.949
Data Source: STRINGDB
OPCML
Tbio
Novelty: 0.01812264
Score: 0.945
Data Source: STRINGDB
NRN1
Tbio
Novelty: 0.00871985
Score: 0.93
Data Source: STRINGDB
NTNG1
Tbio
Novelty: 0.06726353
Score: 0.923
Data Source: STRINGDB
NTNG2
Tbio
Novelty: 0.04650385
Score: 0.92
Data Source: STRINGDB
PRND
Tbio
Novelty: 0.00309217
Score: 0.919
Data Source: STRINGDB
CNTN4
Tbio
Novelty: 0.02725707
Score: 0.917
Data Source: STRINGDB
Publication Statistics
PubMed Score  79.21

PubMed score by year
PubTator Score  37.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGA
1-70
WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPK
70-140
IYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS
140-210
FPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRS
210-280
ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKN
280-350
AILQ
350-354
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ