You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MMP23B
Matrix metalloproteinase-23

Protein Classes
Protein Summary
Description
Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity). This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. This gene belongs to the more telomeric copy of the duplicated region. [provided by RefSeq, Jul 2008]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
transcription factor
0.57
disease
0.54
tissue sample
0.54
PubMedID
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.48   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 327   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.48   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 327   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (33)
1 – 10 of 33
CDK13
Tchem
Family: Kinase
Novelty: 0.04248849
Score: 0.907
Data Source: STRINGDB
CDK11A
Tchem
Family: Kinase
Novelty: 0.02871406
Score: 0.803
Data Source: STRINGDB
CDK11B
Tchem
Family: Kinase
Novelty: 0.03487219
Score: 0.76
Data Source: STRINGDB
COL6A1
Tbio
Novelty: 0.00861534
Score: 0.678
Data Source: STRINGDB
COL5A2
Tbio
Novelty: 0.01919714
Score: 0.649
Data Source: STRINGDB
COL8A1
Tbio
Novelty: 0.03835736
Score: 0.64
Data Source: STRINGDB
HPX
Tbio
Novelty: 0.00131452
Score: 0.569
Data Source: STRINGDB
COL4A5
Tbio
Novelty: 0.00340049
Score: 0.545
Data Source: STRINGDB
ORC1
Tbio
Novelty: 0.03418076
Score: 0.543
Data Source: STRINGDB
HEATR6
Tbio
Novelty: 0.03071029
Score: 0.535
Data Source: STRINGDB
Publication Statistics
PubMed Score  27.48

PubMed score by year
PubTator Score  33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPG
1-70
PLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDL
70-140
RIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAA
140-210
HEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKR
210-280
LCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA
280-350
LGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG
350-390
MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG