You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC17A5
Sialin

Protein Summary
Description
Transports glucuronic acid and free sialic acid out of the lysosome after it is cleaved from sialoglycoconjugates undergoing degradation, this is required for normal CNS myelination. Mediates aspartate and glutamate membrane potential-dependent uptake into synaptic vesicles and synaptic-like microvesicles. Also functions as an electrogenic 2NO(3)(-)/H(+) cotransporter in the plasma membrane of salivary gland acinar cells, mediating the physiological nitrate efflux, 25% of the circulating nitrate ions is typically removed and secreted in saliva. This gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355773
  • ENSP00000348019
  • ENSG00000119899

Symbol
  • SD
  • AST
  • NSD
  • SLD
  • ISSD
  • SIASD
  • SIALIN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.93
pathway
0.88
molecular function
0.79
transcription factor binding site profile
0.77
kinase perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 911.67   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 98   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 911.67   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 98   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Defective SLC17A5 causes Salla disease (SD) and ISSD
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective SLC17A5 causes Salla disease (SD) and ISSD
Disease
Disorders of transmembrane transporters
Protein-Protein Interactions (60)
1 – 10 of 60
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999975167
p_ni: 8.84e-7
p_wrong: 0.000023949
Score: 0.189
Data Source: BioPlex,STRINGDB
TMEM47
Tdark
Novelty: 0.23378792
p_int: 0.794896293
p_ni: 0.000016936
p_wrong: 0.205086771
Data Source: BioPlex
DDC
Tclin
Family: Enzyme
Novelty: 0.0016806
Score: 0.813
Data Source: STRINGDB
STMN4
Tbio
Novelty: 0.00798494
Score: 0.802
Data Source: STRINGDB
MCM4
Tbio
Novelty: 0.00884931
Score: 0.766
Data Source: STRINGDB
DBF4
Tbio
Novelty: 0.01069761
Score: 0.757
Data Source: STRINGDB
CDC7
Tchem
Family: Kinase
Novelty: 0.00526969
Score: 0.719
Data Source: STRINGDB
SLC16A7
Tchem
Family: Transporter
Novelty: 0.00908316
Score: 0.718
Data Source: STRINGDB
SLC16A3
Tchem
Family: Transporter
Novelty: 0.00526367
Score: 0.717
Data Source: STRINGDB
STMN1
Tbio
Novelty: 0.00103914
Score: 0.717
Data Source: STRINGDB
Publication Statistics
PubMed Score  911.67

PubMed score by year
PubTator Score  4205.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDS
1-70
NTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLG
70-140
FGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGT
140-210
VISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKSV
210-280
PWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAAD
280-350
NLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPS
350-420
YAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDH
420-490
HGHRH
490-495
MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHHGHRH