You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NKX2-1
Homeobox protein Nkx-2.1

Protein Summary
Description
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity). This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congen ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354822
  • ENSP00000346879
  • ENSG00000136352
  • ENST00000498187
  • ENSP00000429607
  • ENST00000518149
  • ENSP00000428341
  • ENST00000522719
  • ENSP00000429519

Symbol
  • NKX2A
  • TITF1
  • TTF1
  • BCH
  • BHC
  • NK-2
  • TEBP
  • TTF1
  • NKX2A
  • NMTC1
  • T/EBP
  • TITF1
  • TTF-1
  • NKX2.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
gene perturbation
0.77
phenotype
0.68
biological term
0.67
molecular function
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1305.15   (req: < 5)
Gene RIFs: 237   (req: <= 3)
Antibodies: 958   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1305.15   (req: >= 5)
Gene RIFs: 237   (req: > 3)
Antibodies: 958   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 47
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (50)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (201)
1 – 10 of 201
RET
Tclin
Family: Kinase
Novelty: 0.00035491
Score: 0.907
Data Source: STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.894
Data Source: STRINGDB
SFTPB
Tbio
Novelty: 0.00138979
Score: 0.889
Data Source: STRINGDB
PAX8
Tbio
Family: TF
Novelty: 0.00201585
Score: 0.883
Data Source: STRINGDB
LHX6
Tbio
Family: TF
Novelty: 0.02582227
Score: 0.861
Data Source: STRINGDB
TG
Tbio
Novelty: 0.00012413
Score: 0.857
Data Source: STRINGDB
GATA6
Tbio
Family: TF
Novelty: 0.00338656
Score: 0.853
Data Source: STRINGDB
SFTPC
Tbio
Novelty: 0.00174879
Score: 0.843
Data Source: STRINGDB
NAPSA
Tbio
Family: Enzyme
Novelty: 0.00837309
Score: 0.84
Data Source: STRINGDB
KRT7
Tbio
Novelty: 0.00064709
Score: 0.836
Data Source: STRINGDB
Publication Statistics
PubMed Score  1305.15

PubMed score by year
PubTator Score  914.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHM
1-70
TAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGM
70-140
GGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ
140-210
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA
210-280
SLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
280-350
NSSGSDYGTMSCSTLLYGRTW
350-371
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW