You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
KCNJ11
ATP-sensitive inward rectifier potassium channel 11

Protein Summary
Description
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium (By similarity). Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation. Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a gr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339994
  • ENSP00000345708
  • ENSG00000187486
  • ENST00000528731
  • ENSP00000434755

Symbol
  • BIR
  • HHF2
  • PHHI
  • IKATP
  • TNDM3
  • KIR6.2
  • MODY13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.92
biological term
0.8
cell type or tissue
0.74
cellular component
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1087.28   (req: < 5)
Gene RIFs: 258   (req: <= 3)
Antibodies: 419   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1087.28   (req: >= 5)
Gene RIFs: 258   (req: > 3)
Antibodies: 419   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 26
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 96
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 18
Approved Drugs (18)
1 – 10 of 18
repaglinide
chemical structure image
glibenclamide
chemical structure image
diazoxide
chemical structure image
tolbutamide
chemical structure image
acetohexamide
chemical structure image
glibornuride
chemical structure image
gliclazide
chemical structure image
mitiglinide
chemical structure image
glimepiride
chemical structure image
minoxidil
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (320)
ABC transporter disorders (R-HSA-5619084)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABC transporter disorders
Reactome
ABC-family proteins mediated transport
Reactome
ATP sensitive Potassium channels
Reactome
Cardiac conduction
Reactome
Defective ABCC8 can cause hypoglycemias and hyperglycemias
Name
Explore in Pharos
Explore in Source
ABC transporter disorders
ABC-family proteins mediated transport
ATP sensitive Potassium channels
Cardiac conduction
Defective ABCC8 can cause hypoglycemias and hyperglycemias
Gene Ontology Terms (41)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Traceable Author Statement (TAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (148)
1 – 10 of 148
IL17RC
Tclin
Novelty: 0.02676926
p_int: 0.999503796
p_ni: 0.000483825
p_wrong: 0.000012379
Data Source: BioPlex
CDH5
Tbio
Novelty: 0.00096405
p_int: 0.999494611
p_ni: 0.000201024
p_wrong: 0.000304365
Data Source: BioPlex
PCDHB16
Tdark
Novelty: 1.08433735
p_int: 0.999043773
p_ni: 0.000689544
p_wrong: 0.000266682
Data Source: BioPlex
TRPM8
Tclin
Family: IC
Novelty: 0.00200706
p_int: 0.99735439
p_ni: 0.001645834
p_wrong: 0.000999776
Score: 0.29
Data Source: BioPlex,STRINGDB
PCDHAC2
Tdark
Novelty: 0.41763341
p_int: 0.996819113
p_ni: 0.002260776
p_wrong: 0.000920111
Data Source: BioPlex
GDPD5
Tbio
Family: Enzyme
Novelty: 0.06263048
p_int: 0.996381633
p_ni: 0.00256512
p_wrong: 0.001053247
Score: 0.156
Data Source: BioPlex,STRINGDB
SLC17A2
Tdark
Family: Transporter
Novelty: 0.66666667
p_int: 0.9932788
p_ni: 0.00670381
p_wrong: 0.00001739
Score: 0.157
Data Source: BioPlex,STRINGDB
MINDY2
Tbio
Novelty: 0.5060241
p_int: 0.954093574
p_ni: 0.000153659
p_wrong: 0.045752768
Score: 0.217
Data Source: BioPlex,STRINGDB
ABCC8
Tclin
Family: Transporter
Novelty: 0.00114123
Score: 0.998
Data Source: Reactome,STRINGDB
ABCC9
Tclin
Family: Transporter
Novelty: 0.02107484
Score: 0.989
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1087.28

PubMed score by year
PubTator Score  778.69

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPH
1-70
TLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTE
70-140
ECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMI
140-210
ISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQD
210-280
LEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLD
280-350
EDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
350-390
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS