You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SPRY4
Protein sprouty homolog 4

Protein Summary
Description
Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. Inhibits Ras-independent, but not Ras-dependent, activation of RAF1. This gene encodes a member of a family of cysteine- and proline-rich proteins. The encoded protein is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. Activity of this protein impairs the formation of active GTP-RAS. Nucleotide variation in this gene has been associated with hypogonadotropic hypogonadism 17 with or without anosmia. Alternative splicing results in a multiple transcript variants. [provided by RefSeq, Jun 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000434127
  • ENSP00000399468
  • ENSG00000187678

Symbol
  • HH17
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.95
transcription factor perturbation
0.91
PubMedID
0.86
gene perturbation
0.79
transcription factor
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.36   (req: < 5)
Gene RIFs: 43   (req: <= 3)
Antibodies: 274   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.36   (req: >= 5)
Gene RIFs: 43   (req: > 3)
Antibodies: 274   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: panther
EGF receptor signaling pathway
PathwayCommons: panther
FGF signaling pathway
PathwayCommons: netpath
EGFR1
Name
Explore in Pharos
Explore in Source
EGF receptor signaling pathway
FGF signaling pathway
EGFR1
Gene Ontology Terms (8)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (71)
1 – 10 of 71
PIP4K2B
Tchem
Family: Kinase
Novelty: 0.11752136
p_int: 0.995369688
p_ni: 0.004630312
Score: 0.345
Data Source: BioPlex,STRINGDB
ORMDL3
Tbio
Novelty: 0.01336886
p_int: 0.957789495
p_ni: 3.75e-7
p_wrong: 0.04221013
Score: 0.54
Data Source: BioPlex,STRINGDB
CBL
Tbio
Family: Enzyme
Novelty: 0.00118988
Score: 0.961
Data Source: STRINGDB
SPRY2
Tbio
Novelty: 0.01058901
Score: 0.948
Data Source: STRINGDB
SPRY1
Tbio
Novelty: 0.00539962
Score: 0.932
Data Source: STRINGDB
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.93
Data Source: STRINGDB
SPRY3
Tbio
Novelty: 0.10243032
Score: 0.928
Data Source: STRINGDB
RASA1
Tbio
Family: Enzyme
Novelty: 0.00312451
Score: 0.924
Data Source: STRINGDB
PTPRB
Tchem
Family: Enzyme
Novelty: 0.00723467
Score: 0.907
Data Source: STRINGDB
TESK1
Tchem
Family: Kinase
Novelty: 0.0811126
Score: 0.888
Data Source: STRINGDB
Publication Statistics
PubMed Score  49.36

PubMed score by year
PubTator Score  84.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGG
1-70
APELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQP
70-140
LDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHC
140-210
TNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
210-280
VICKAASGDAKTSRPDKPF
280-299
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF