You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IL17A
Interleukin-17A

Protein Summary
Description
Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines (PubMed:8676080). The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340057
  • ENSP00000344192
  • ENSG00000112115
  • ENST00000648244
  • ENSP00000497968

Symbol
  • CTLA8
  • IL17
  • IL17
  • CTLA8
  • IL-17
  • CTLA-8
  • IL-17A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
biological process
0.8
chemical
0.79
cell type or tissue
0.76
gene perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5744.3   (req: < 5)
Gene RIFs: 1104   (req: <= 3)
Antibodies: 1677   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5744.3   (req: >= 5)
Gene RIFs: 1104   (req: > 3)
Antibodies: 1677   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-17 signaling
Reactome
Interleukin-4 and Interleukin-13 signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-17 signaling
Interleukin-4 and Interleukin-13 signaling
Signaling by Interleukins
Gene Ontology Terms (14)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (497)
1 – 10 of 497
IL2
Tchem
Novelty: 0.00004362
p_int: 0.999999999
p_ni: 1e-9
Score: 0.982
Data Source: BioPlex,STRINGDB
DPP8
Tchem
Family: Enzyme
Novelty: 0.00982302
p_int: 0.998987533
p_ni: 0.001012445
p_wrong: 2.3e-8
Score: 0.241
Data Source: BioPlex,STRINGDB
LONP2
Tbio
Family: Enzyme
Novelty: 0.06368768
p_int: 0.997777279
p_ni: 0.002222713
p_wrong: 8e-9
Score: 0.28
Data Source: BioPlex,STRINGDB
TXNDC15
Tbio
Novelty: 0.0004225
p_int: 0.97058669
p_ni: 0.029413309
p_wrong: 1e-9
Score: 0.177
Data Source: BioPlex,STRINGDB
IL17RA
Tclin
Novelty: 0.00599602
p_int: 0.939158729
p_ni: 0.060841271
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.993
Data Source: STRINGDB
IL17F
Tbio
Novelty: 0.00311315
Score: 0.986
Data Source: Reactome,STRINGDB
IL17RC
Tclin
Novelty: 0.02676926
Score: 0.985
Data Source: Reactome,STRINGDB
STAT6
Tchem
Family: TF
Novelty: 0.00118956
Score: 0.982
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.971
Data Source: STRINGDB
Publication Statistics
PubMed Score  5744.30

PubMed score by year
PubTator Score  3470.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS
1-70
TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV
70-140
SVGCTCVTPIVHHVA
140-155
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA