You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOXM1
Forkhead box protein M1

Protein Summary
Description
Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342628
  • ENSP00000342307
  • ENSG00000111206
  • ENST00000359843
  • ENSP00000352901
  • ENST00000361953
  • ENSP00000354492

Symbol
  • FKHL16
  • HFH11
  • MPP2
  • WIN
  • MPP2
  • HFH11
  • HNF-3
  • INS-1
  • MPP-2
  • PIG29
  • FKHL16
  • FOXM1A
  • FOXM1B
  • FOXM1C
  • HFH-11
  • TRIDENT
  • MPHOSPH2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.94
co-expressed gene
0.91
transcription factor perturbation
0.88
kinase
0.8
histone modification site profile
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1576.06   (req: < 5)
Gene RIFs: 381   (req: <= 3)
Antibodies: 432   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1576.06   (req: >= 5)
Gene RIFs: 381   (req: > 3)
Antibodies: 432   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cyclin A/B1/B2 associated events during G2/M transition
Reactome
G2/M Transition
Reactome
Mitotic G2-G2/M phases
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Cyclin A/B1/B2 associated events during G2/M transition
G2/M Transition
Mitotic G2-G2/M phases
Gene Ontology Terms (25)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred by Curator (IC)
NTNU_SB
Protein-Protein Interactions (340)
1 – 10 of 340
CTLA4
Tclin
Novelty: 0.00017405
p_int: 0.999647448
p_ni: 0.000005822
p_wrong: 0.00034673
Score: 0.223
Data Source: BioPlex,STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
Score: 0.997
Data Source: STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.997
Data Source: Reactome,STRINGDB
PLK1
Tchem
Family: Kinase
Novelty: 0.00071387
Score: 0.997
Data Source: Reactome,STRINGDB
CCNA2
Tchem
Novelty: 0.00061948
Score: 0.996
Data Source: STRINGDB
MYBL2
Tbio
Family: TF
Novelty: 0.00580155
Score: 0.992
Data Source: Reactome,STRINGDB
CCNB2
Tbio
Novelty: 0.01021878
Score: 0.991
Data Source: STRINGDB
CENPF
Tbio
Novelty: 0.00870005
Score: 0.991
Data Source: STRINGDB
CDC25A
Tchem
Family: Enzyme
Novelty: 0.00322177
Score: 0.988
Data Source: STRINGDB
CDK2
Tchem
Family: Kinase
Novelty: 0.00033882
Score: 0.988
Data Source: STRINGDB
Publication Statistics
PubMed Score  1576.06

PubMed score by year
PubTator Score  872.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTM
1-70
PNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLET
70-140
LGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENC
140-210
HLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPG
210-280
WKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELR
280-350
RNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
350-420
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSP
420-490
APSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPEL
490-560
LFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPA
560-630
KVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVP
630-700
KPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
700-763
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ