You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
STAT5A
Signal transducer and activator of transcription 5A

Protein Classes
Protein Summary
Description
Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation. The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is indepen ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000345506
  • ENSP00000341208
  • ENSG00000126561
  • ENST00000546010
  • ENSP00000443107
  • ENST00000590949
  • ENSP00000468749

Symbol
  • STAT5
  • MGF
  • STAT5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
hub protein
1
biological term
0.99
protein domain
0.99
kinase
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1016.91   (req: < 5)
Gene RIFs: 243   (req: <= 3)
Antibodies: 1597   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1016.91   (req: >= 5)
Gene RIFs: 243   (req: > 3)
Antibodies: 1597   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 4
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (125)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 32
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Downstream signal transduction
Reactome
Erythropoietin activates STAT5
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Downstream signal transduction
Erythropoietin activates STAT5
Protein-Protein Interactions (400)
1 – 10 of 400
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.949
Data Source: BioPlex,Reactome,STRINGDB
TLR2
Tchem
Novelty: 0.0002624
p_int: 0.99999948
p_ni: 5.2e-7
Score: 0.531
Data Source: BioPlex,STRINGDB
PDK2
Tchem
Family: Kinase
Novelty: 0.01418114
p_int: 0.998097989
p_ni: 0.001902007
p_wrong: 3e-9
Score: 0.841
Data Source: BioPlex,STRINGDB
PDK3
Tchem
Family: Kinase
Novelty: 0.08817749
p_int: 0.990850798
p_ni: 0.009149202
Score: 0.81
Data Source: BioPlex,STRINGDB
KLHL7
Tbio
Novelty: 0.08257193
p_int: 0.98834235
p_ni: 0.000646015
p_wrong: 0.011011635
Score: 0.251
Data Source: BioPlex,STRINGDB
PDHA1
Tbio
Family: Enzyme
Novelty: 0.00498626
p_int: 0.987428381
p_ni: 0.012571619
Score: 0.843
Data Source: BioPlex,STRINGDB
PDHB
Tbio
Family: Enzyme
Novelty: 0.01625694
p_int: 0.953396547
p_ni: 0.046603453
Score: 0.826
Data Source: BioPlex,STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.999
Data Source: Reactome,STRINGDB
JAK3
Tclin
Family: Kinase
Novelty: 0.00219647
Score: 0.997
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.996
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1016.91

PubMed score by year
PubTator Score  1256.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQK
1-70
KAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQK
70-140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVS
140-210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE
210-280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA
280-350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
350-420
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAE
420-490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR
490-560
ENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA
560-630
WKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIK
630-700
QVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRR
700-770
PMDSLDSRLSPPAGLFTSARGSLS
770-794
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS