You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DMP1
Dentin matrix acidic phosphoprotein 1

Protein Summary
Description
May have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase it is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite. Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000282479
  • ENSP00000282479
  • ENSG00000152592
  • ENST00000339673
  • ENSP00000340935

Symbol
  • ARHP
  • ARHR
  • DMP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.76
disease perturbation
0.68
microRNA
0.65
cell type or tissue
0.61
kinase perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.03   (req: < 5)
Gene RIFs: 53   (req: <= 3)
Antibodies: 289   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 52.03   (req: >= 5)
Gene RIFs: 53   (req: > 3)
Antibodies: 289   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
ECM proteoglycans (R-HSA-3000178)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ECM proteoglycans
Reactome
Extracellular matrix organization
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Post-translational protein phosphorylation
Name
Explore in Pharos
Explore in Source
ECM proteoglycans
Extracellular matrix organization
Metabolism of proteins
Post-translational protein modification
Post-translational protein phosphorylation
Gene Ontology Terms (14)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (133)
1 – 10 of 133
FGF23
Tclin
Novelty: 0.00057077
Score: 0.982
Data Source: STRINGDB
FAM20C
Tbio
Family: Enzyme
Novelty: 0.004596
Score: 0.973
Data Source: STRINGDB
MEPE
Tbio
Novelty: 0.00827573
Score: 0.97
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.961
Data Source: STRINGDB
AMBN
Tbio
Novelty: 0.00438592
Score: 0.951
Data Source: STRINGDB
AMTN
Tbio
Novelty: 0.03727359
Score: 0.949
Data Source: STRINGDB
ENAM
Tbio
Novelty: 0.00705934
Score: 0.949
Data Source: STRINGDB
AMELX
Tbio
Novelty: 0.0005058
Score: 0.938
Data Source: STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.934
Data Source: STRINGDB
SPARCL1
Tbio
Novelty: 0.01525848
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  52.03

PubMed score by year
PubTator Score  236.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDST
1-70
QSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDS
70-140
DDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSEL
140-210
DDEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRS
210-280
ELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQE
280-350
NSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE
350-420
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRK
420-490
LTVDAYHNKPIGDQDDNDCQDGY
490-513
MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDSTQSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSELDDEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPESPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGY