You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PRDM8
PR domain zinc finger protein 8

Protein Summary
Description
Probable histone methyltransferase, preferentially acting on 'Lys-9' of histone H3 (By similarity). Involved in the control of steroidogenesis through transcriptional repression of steroidogenesis marker genes such as CYP17A1 and LHCGR (By similarity). Forms with BHLHE22 a transcriptional repressor complex controlling genes involved in neural development and neuronal differentiation (By similarity). In the retina, it is required for rod bipolar and type 2 OFF-cone bipolar cell survival (By similarity). This gene encodes a protein that belongs to a conserved family of histone methyltransferases that predominantly act as negative regulators of transcription. The encoded protein contains an N-terminal Su(var)3-9, Enhancer-of-zeste, and Trithorax (SET) domain and a double zinc-finger domain. Knockout of this gene in mouse results in mistargeting by neurons of the dorsal telencephalon, abnormal itch-like behavior, and impaired differentiation of rod bipolar cells. In humans, the protein has ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339711
  • ENSP00000339764
  • ENSG00000152784
  • ENST00000415738
  • ENSP00000406998
  • ENST00000504452
  • ENSP00000423985

Symbol
  • PFM5
  • PFM5
  • EPM10
  • KMT8D
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
transcription factor
0.8
biological process
0.75
PubMedID
0.62
tissue sample
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.08   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 108   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.08   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 108   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (25)
1 – 10 of 25
PRDM6
Tbio
Family: TF; Epigenetic
Novelty: 0.06348253
Score: 0.785
Data Source: STRINGDB
BHLHE22
Tbio
Family: TF
Novelty: 0.00089151
Score: 0.779
Data Source: STRINGDB
EPM2A
Tbio
Family: Enzyme
Novelty: 0.00625845
Score: 0.767
Data Source: STRINGDB
EPM2A
Tbio
Novelty: 0.00625845
Score: 0.767
Data Source: STRINGDB
NHLRC1
Tbio
Family: Enzyme
Novelty: 0.01215525
Score: 0.717
Data Source: STRINGDB
PRDM2
Tbio
Family: TF; Epigenetic
Novelty: 0.00685182
Score: 0.706
Data Source: STRINGDB
PRDM15
Tdark
Family: TF; Epigenetic
Novelty: 0.43323861
Score: 0.69
Data Source: STRINGDB
EBF4
Tbio
Family: TF
Novelty: 0.11214953
Score: 0.658
Data Source: STRINGDB
PRDM5
Tbio
Family: TF; Epigenetic
Novelty: 0.01560016
Score: 0.595
Data Source: STRINGDB
BTBD3
Tdark
Novelty: 0.2303263
Score: 0.55
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.08

PubMed score by year
PubTator Score  5.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPY
1-70
IFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRIAKDEELLVWYGKELTELLLL
70-140
CPSRSHNKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPKRLHSADISPQDEQGGGVGTKDHGGGGGGGK
140-210
DQQQQQQEAPLGPGPKFCKAGPLHHYPSPSPESSNPSAAAGGSSAKPSTDFHNLARELENSRGGSSCSPA
210-280
QSLSSGSGSGGGGGHQEAELSPDGIATGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVC
280-350
TPQQYRASGSYFGLEENGRLFAPPSPETGEAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGG
350-420
GSSTPAAASPVGAEKLLAPRPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGAGAAGGAGGGQ
420-490
GAASDERKSAFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPAAADPLAVKLQGAADLNGGCG
490-560
SLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGPLQLQLPSALTLLPPSFTSLCLPAQNWCAKC
560-630
NASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSHN
630-689
MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRIAKDEELLVWYGKELTELLLLCPSRSHNKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPKRLHSADISPQDEQGGGVGTKDHGGGGGGGKDQQQQQQEAPLGPGPKFCKAGPLHHYPSPSPESSNPSAAAGGSSAKPSTDFHNLARELENSRGGSSCSPAQSLSSGSGSGGGGGHQEAELSPDGIATGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVCTPQQYRASGSYFGLEENGRLFAPPSPETGEAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGGGSSTPAAASPVGAEKLLAPRPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGAGAAGGAGGGQGAASDERKSAFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPAAADPLAVKLQGAADLNGGCGSLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGPLQLQLPSALTLLPPSFTSLCLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSHN