You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RHD
Blood group Rh(D) polypeptide

Protein Summary
Description
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328664
  • ENSP00000331871
  • ENSG00000187010
  • ENST00000342055
  • ENSP00000339577
  • ENST00000357542
  • ENSP00000350150
  • ENST00000417538
  • ENSP00000396420
  • ENST00000454452
  • ENSP00000413849

Symbol
  • RH
  • Rh4
  • RH30
  • RhII
  • RhPI
  • DIIIc
  • RHCED
  • RHDel
  • RHPII
  • RhDCw
  • CD240D
  • RHXIII
  • RHDVA(TT)
  • RhK562-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.81
biological term
0.8
cell type or tissue
0.63
transcription factor perturbation
0.61
cell line
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 717.59   (req: < 5)
Gene RIFs: 101   (req: <= 3)
Antibodies: 178   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 717.59   (req: >= 5)
Gene RIFs: 101   (req: > 3)
Antibodies: 178   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Blood group systems biosynthesis (R-HSA-9033658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Blood group systems biosynthesis
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Reactome
Rhesus blood group biosynthesis
Name
Explore in Pharos
Explore in Source
Blood group systems biosynthesis
Metabolism
Metabolism of carbohydrates
Rhesus blood group biosynthesis
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (25)
1 – 10 of 25
GYPB
Tbio
Novelty: 0.00257625
Score: 0.753
Data Source: STRINGDB
PAX3
Tbio
Family: TF
Novelty: 0.00139998
Score: 0.688
Data Source: STRINGDB
CD47
Tchem
Novelty: 0.00158939
Score: 0.642
Data Source: STRINGDB
ABO
Tbio
Family: Enzyme
Novelty: 0.00045035
Score: 0.63
Data Source: STRINGDB
FOXO1
Tbio
Family: TF
Novelty: 0.00076606
Score: 0.612
Data Source: STRINGDB
KEL
Tbio
Family: Enzyme
Novelty: 0.00241804
Score: 0.604
Data Source: STRINGDB
KIDINS220
Tbio
Family: Enzyme
Novelty: 0.00070004
Score: 0.585
Data Source: STRINGDB
MACO1
Tbio
Novelty: 0.20051648
Score: 0.584
Data Source: STRINGDB
RBL2
Tbio
Novelty: 0.00183781
Score: 0.553
Data Source: STRINGDB
STMN4
Tbio
Novelty: 0.00798494
Score: 0.53
Data Source: STRINGDB
Publication Statistics
PubMed Score  717.59

PubMed score by year
PubTator Score  1357.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFR
1-70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLV
70-140
VMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM
140-210
LGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVA
210-280
VGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLD
280-350
TVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
350-417
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLDTVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF