You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-DQA1
HLA class II histocompatibility antigen, DQ alpha 1 chain

Protein Summary
Description
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loa ...more
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.97
biological term
0.95
disease
0.93
phenotype
0.77
tissue sample
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1787.45   (req: < 5)
Gene RIFs: 235   (req: <= 3)
Antibodies: 638   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1787.45   (req: >= 5)
Gene RIFs: 235   (req: > 3)
Antibodies: 638   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (44)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Downstream TCR signaling
Reactome
Generation of second messenger molecules
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Downstream TCR signaling
Generation of second messenger molecules
Gene Ontology Terms (19)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (341)
1 – 10 of 341
GALT
Tbio
Family: Enzyme
Novelty: 0.00883448
p_int: 0.999652656
p_ni: 0.00018898
p_wrong: 0.000158364
Score: 0.228
Data Source: BioPlex,STRINGDB
TMEM219
Tdark
Novelty: 0.4851752
p_int: 0.996264602
p_ni: 0.003660364
p_wrong: 0.000075034
Score: 0.163
Data Source: BioPlex,STRINGDB
SLC38A9
Tbio
Family: Transporter
Novelty: 0.11535293
p_int: 0.995164633
p_ni: 0.004834689
p_wrong: 6.78e-7
Score: 0.163
Data Source: BioPlex,STRINGDB
MFSD8
Tbio
Novelty: 0.01280168
p_int: 0.994082648
p_ni: 0.005917248
p_wrong: 1.04e-7
Score: 0.158
Data Source: BioPlex,STRINGDB
EFNB1
Tbio
Novelty: 0.00491089
p_int: 0.992083573
p_ni: 0.007916426
p_wrong: 1e-9
Data Source: BioPlex
CUX1
Tbio
Novelty: 0.00305461
p_int: 0.985380763
p_ni: 0.014619235
p_wrong: 2e-9
Score: 0.163
Data Source: BioPlex,STRINGDB
MYO19
Tbio
Novelty: 0.10291595
p_int: 0.982035001
p_ni: 0.017964999
Score: 0.188
Data Source: BioPlex,STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
p_int: 0.977883261
p_ni: 0.022116739
Score: 0.979
Data Source: BioPlex,STRINGDB
KCNJ8
Tbio
Family: IC
Novelty: 0.00457979
p_int: 0.966262023
p_ni: 0.033737975
p_wrong: 2e-9
Score: 0.173
Data Source: BioPlex,STRINGDB
CD14
Tbio
Novelty: 0.01019035
p_int: 0.923122317
p_ni: 0.00011445
p_wrong: 0.076763233
Data Source: BioPlex
Publication Statistics
PubMed Score  1787.45

PubMed score by year
PubTator Score  900.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWC
1-70
LPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPP
70-140
VVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAP
140-210
MSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL
210-254
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL