You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CAV1
Caveolin-1

Protein Summary
Description
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (PubMed:25893292). Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed:19262564). The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000341049
  • ENSP00000339191
  • ENSG00000105974
  • ENST00000393467
  • ENSP00000377110
  • ENST00000393468
  • ENSP00000377111
  • ENST00000405348
  • ENSP00000384348
  • ENST00000614113
  • ENSP00000479447

Symbol
  • CAV
  • CGL3
  • PPH3
  • BSCL3
  • LCCNS
  • VIP21
  • MSTP085
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
hub protein
1
gene perturbation
0.99
PubMedID
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2596.52   (req: < 5)
Gene RIFs: 726   (req: <= 3)
Antibodies: 1107   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2596.52   (req: >= 5)
Gene RIFs: 726   (req: > 3)
Antibodies: 1107   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 114
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (58)
Basigin interactions (R-HSA-210991)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 26
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Basigin interactions
Reactome
Cell surface interactions at the vascular wall
Reactome
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Reactome
ESR-mediated signaling
Reactome
Extra-nuclear estrogen signaling
Name
Explore in Pharos
Explore in Source
Basigin interactions
Cell surface interactions at the vascular wall
Disassembly of the destruction complex and recruitment of AXIN to the membrane
ESR-mediated signaling
Extra-nuclear estrogen signaling
Gene Ontology Terms (136)
Items per page:
10
1 – 10 of 16
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
AgBase
Inferred from Physical Interaction (IPI)
BHF-UCL
Protein-Protein Interactions (437)
1 – 10 of 437
CC2D1A
Tbio
Novelty: 0.01893881
p_int: 0.999999818
p_ni: 1.82e-7
Data Source: BioPlex
YIPF3
Tbio
Novelty: 0.03141831
p_int: 0.999975774
p_ni: 0.000024226
Data Source: BioPlex
SMPD3
Tbio
Family: Enzyme
Novelty: 0.01367455
p_int: 0.999964587
p_ni: 0.000032627
p_wrong: 0.000002786
Score: 0.272
Data Source: BioPlex,STRINGDB
SLC22A9
Tbio
Family: Transporter
Novelty: 0.02803169
p_int: 0.999944682
p_ni: 0.000055318
Score: 0.217
Data Source: BioPlex,STRINGDB
CAV3
Tbio
Novelty: 0.00250765
p_int: 0.999885841
p_ni: 0.000113977
p_wrong: 1.83e-7
Score: 0.825
Data Source: BioPlex,STRINGDB
MSRB2
Tbio
Family: Enzyme
Novelty: 0.01205613
p_int: 0.999885527
p_ni: 0.000114061
p_wrong: 4.12e-7
Data Source: BioPlex
TACR1
Tclin
Family: GPCR
Novelty: 0.00074286
p_int: 0.99960269
p_ni: 0.00039731
p_wrong: 1e-9
Score: 0.174
Data Source: BioPlex,STRINGDB
FAF2
Tbio
Novelty: 0.03242029
p_int: 0.99960071
p_ni: 0.000381592
p_wrong: 0.000017698
Data Source: BioPlex
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
p_int: 0.99946444
p_ni: 0.000527683
p_wrong: 0.000007877
Data Source: BioPlex
HK1
Tchem
Family: Kinase
Novelty: 0.00089993
p_int: 0.99583932
p_ni: 0.002136622
p_wrong: 0.002024058
Score: 0.277
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2596.52

PubMed score by year
PubTator Score  2703.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED
1-70
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE
70-140
IQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
140-178
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI