You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AIDA
Axin interactor, dorsalization-associated protein

Protein Summary
Description
Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340020
  • ENSP00000339161
  • ENSG00000186063
  • ENST00000355727
  • ENSP00000347964

Symbol
  • C1orf80
  • C1orf80
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
transcription factor perturbation
0.8
histone modification site profile
0.72
interacting protein
0.71
disease perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.85   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.85   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (19)
1 – 10 of 19
TMEM185A
Tdark
Novelty: 0.03619125
p_int: 0.999941113
p_ni: 0.000045657
p_wrong: 0.00001323
Data Source: BioPlex
SLC25A41
Tdark
Family: Transporter
Novelty: 2.02597403
p_int: 0.999876813
p_ni: 0.000123187
Data Source: BioPlex
FSD1
Tbio
Novelty: 0.043447
p_int: 0.9986703
p_ni: 0.001308298
p_wrong: 0.000021402
Score: 0.183
Data Source: BioPlex,STRINGDB
NFKBIA
Tchem
Novelty: 0.00044
p_int: 0.9986703
p_ni: 0.001308298
p_wrong: 0.000021402
Score: 0.177
Data Source: BioPlex,STRINGDB
TNFAIP3
Tbio
Novelty: 0.00313805
p_int: 0.957896381
p_ni: 0.013190803
p_wrong: 0.028912816
Score: 0.188
Data Source: BioPlex,STRINGDB
EMSY
Tbio
Novelty: 0.02905792
Score: 0.8
Data Source: STRINGDB
DCAF7
Tbio
Novelty: 0.01725153
Score: 0.62
Data Source: STRINGDB
PAGE2B
Tdark
Novelty: 2.1
Score: 0.552
Data Source: STRINGDB
RPL36A
Tbio
Novelty: 0.07437745
Score: 0.544
Data Source: STRINGDB
GRM8
Tchem
Family: GPCR
Novelty: 0.00998475
Score: 0.525
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.85

PubMed score by year
PubTator Score  163.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCL
1-70
ELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGA
70-140
GAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVA
140-210
SRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPT
210-280
DFKRKKLQLLTKKPLYLHLHQTLHKE
280-306
MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE