You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SSX2
Protein SSX2

Protein Summary
Description
Could act as a modulator of transcription. The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX1 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. This gene also has an identical duplicate, GeneID: 727837, located about 45 kb downstream in the opposite orientation on chromosome X. [pr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000336777
  • ENSP00000338796
  • ENSG00000241476
  • ENST00000337502
  • ENSP00000338561
  • ENST00000596480
  • ENSP00000470740
  • ENSG00000268447
  • ENST00000612490
  • ENSP00000477922
  • ENST00000616191
  • ENSP00000478714

Symbol
  • SSX2A
  • SSX
  • HD21
  • CT5.2
  • CT5.2A
  • HOM-MEL-40
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.69
cell type or tissue
0.63
cellular component
0.44
microRNA
0.41
cell line
0.32


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 300.34   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 241   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 300.34   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 241   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (83)
1 – 10 of 83
SSX7
Tdark
Novelty: 5
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.877
Data Source: BioPlex,STRINGDB
SSX5
Tdark
Novelty: 0.50621816
p_int: 0.999999994
p_wrong: 6e-9
Score: 0.416
Data Source: BioPlex,STRINGDB
SSX6
Tdark
p_int: 0.999998648
p_ni: 2e-9
p_wrong: 0.00000135
Data Source: BioPlex
SESTD1
Tbio
Novelty: 0.1805301
p_int: 0.99999735
p_ni: 0.00000265
Score: 0.161
Data Source: BioPlex,STRINGDB
SSX3
Tdark
Novelty: 0.49605411
p_int: 0.999993876
p_ni: 0.000006117
p_wrong: 8e-9
Score: 0.849
Data Source: BioPlex,STRINGDB
METTL18
Tdark
Family: Enzyme
Novelty: 0.57142857
p_int: 0.999495399
p_ni: 0.00041346
p_wrong: 0.000091141
Score: 0.319
Data Source: BioPlex,STRINGDB
AKAP9
Tbio
Family: Enzyme
Novelty: 0.0055702
p_int: 0.999193422
p_ni: 0.000806577
p_wrong: 1e-9
Score: 0.547
Data Source: BioPlex,STRINGDB
AMD1
Tchem
Family: Enzyme
Novelty: 0.00107659
p_int: 0.997901358
p_ni: 0.002098642
Data Source: BioPlex
KIF3A
Tbio
Novelty: 0.00780024
p_int: 0.990667092
p_ni: 0.009332908
Data Source: BioPlex
CUL7
Tbio
Novelty: 0.03071523
p_int: 0.989578084
p_ni: 0.010421912
p_wrong: 4e-9
Score: 0.186
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  300.34

PubMed score by year
PubTator Score  94.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF
1-70
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC
70-140
PPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
140-188
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE