Protein Classes
Protein Summary
Could act as a modulator of transcription. The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX1 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. This gene also has an identical duplicate, GeneID: 727837, located about 45 kb downstream in the opposite orientation on chromosome X. [pr ...more
- ENST00000336777
- ENSP00000338796
- ENSG00000241476
- ENST00000337502
- ENSP00000338561
- ENST00000596480
- ENSP00000470740
- ENSG00000268447
- ENST00000612490
- ENSP00000477922
- ENST00000616191
- ENSP00000478714
- SSX2A
- SSX
- HD21
- CT5.2
- CT5.2A
- HOM-MEL-40
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
tissue | 0.69 | ||
cell type or tissue | 0.63 | ||
cellular component | 0.44 | ||
microRNA | 0.41 | ||
cell line | 0.32 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 300.34 (req: < 5)
Gene RIFs: 17 (req: <= 3)
Antibodies: 241 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 300.34 (req: >= 5)
Gene RIFs: 17 (req: > 3)
Antibodies: 241 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 2
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (1)
KEGG (1)
Items per page:
1 – 1 of 1
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
KEGG | Transcriptional misregulation in cancer | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Transcriptional misregulation in cancer | ||||
Gene Ontology Terms (3)
Functions (1)
Components (1)
Processes (1)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (83)
1 – 10 of 83
SSX7
Novelty: 5
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.877
Data Source: BioPlex,STRINGDB
SSX5
Novelty: 0.50621816
p_int: 0.999999994
p_wrong: 6e-9
Score: 0.416
Data Source: BioPlex,STRINGDB
SSX6
p_int: 0.999998648
p_ni: 2e-9
p_wrong: 0.00000135
Data Source: BioPlex
SESTD1
Novelty: 0.1805301
p_int: 0.99999735
p_ni: 0.00000265
Score: 0.161
Data Source: BioPlex,STRINGDB
SSX3
Novelty: 0.49605411
p_int: 0.999993876
p_ni: 0.000006117
p_wrong: 8e-9
Score: 0.849
Data Source: BioPlex,STRINGDB
METTL18
Family: Enzyme
Novelty: 0.57142857
p_int: 0.999495399
p_ni: 0.00041346
p_wrong: 0.000091141
Score: 0.319
Data Source: BioPlex,STRINGDB
AKAP9
Family: Enzyme
Novelty: 0.0055702
p_int: 0.999193422
p_ni: 0.000806577
p_wrong: 1e-9
Score: 0.547
Data Source: BioPlex,STRINGDB
AMD1
Family: Enzyme
Novelty: 0.00107659
p_int: 0.997901358
p_ni: 0.002098642
Data Source: BioPlex
KIF3A
Novelty: 0.00780024
p_int: 0.990667092
p_ni: 0.009332908
Data Source: BioPlex
CUL7
Novelty: 0.03071523
p_int: 0.989578084
p_ni: 0.010421912
p_wrong: 4e-9
Score: 0.186
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 300.34
PubMed score by year
PubTator Score 94.21
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF
1-70
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC
70-140
PPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
140-188
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
Find similar targets by: