You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SNCA
Alpha-synuclein

Protein Summary
Description
May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation. Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000336904
  • ENSP00000338345
  • ENSG00000145335
  • ENST00000345009
  • ENSP00000343683
  • ENST00000394986
  • ENSP00000378437
  • ENST00000394989
  • ENSP00000378440
  • ENST00000394991
  • ENSP00000378442
  • ENST00000420646
  • ENSP00000396241
  • ENST00000505199
  • ENSP00000421485
  • ENST00000506244
  • ENSP00000422238
  • ENST00000508895
  • ENSP00000426955
  • ENST00000618500
  • ENSP00000484044

Symbol
  • NACP
  • PARK1
  • PD1
  • NACP
  • PARK1
  • PARK4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
hub protein
1
kinase
1
molecular function
1
biological term
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4602.11   (req: < 5)
Gene RIFs: 1403   (req: <= 3)
Antibodies: 2667   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4602.11   (req: >= 5)
Gene RIFs: 1403   (req: > 3)
Antibodies: 2667   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 99
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 165
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Amyloid fiber formation (R-HSA-977225)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amyloid fiber formation
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Amyloid fiber formation
Metabolism of proteins
Gene Ontology Terms (128)
Items per page:
10
1 – 10 of 24
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (305)
1 – 10 of 305
MAN2C1
Tbio
Family: Enzyme
Novelty: 0.0049976
p_int: 0.999995048
p_ni: 0.000004908
p_wrong: 4.4e-8
Score: 0.354
Data Source: BioPlex,STRINGDB
TMPRSS12
Tdark
Family: Enzyme
Novelty: 0.70588235
p_int: 0.997573342
p_ni: 0.002426658
Score: 0.208
Data Source: BioPlex,STRINGDB
HK1
Tchem
Family: Kinase
Novelty: 0.00089993
p_int: 0.992731345
p_ni: 0.007268655
Score: 0.254
Data Source: BioPlex,STRINGDB
DNAAF2
Tbio
Novelty: 0.04657397
p_int: 0.945120326
p_ni: 0.054879649
p_wrong: 2.5e-8
Data Source: BioPlex
HCLS1
Tbio
Novelty: 0.06481982
p_int: 0.915728689
p_ni: 0.006128783
p_wrong: 0.078142528
Score: 0.269
Data Source: BioPlex,STRINGDB
SERPINB13
Tbio
Novelty: 0.03180119
p_int: 0.882892549
p_ni: 0.117106916
p_wrong: 5.35e-7
Score: 0.165
Data Source: BioPlex,STRINGDB
SNCAIP
Tbio
Novelty: 0.01175869
Score: 0.996
Data Source: Reactome,STRINGDB
PRKN
Tbio
Family: Enzyme
Novelty: 0.00092228
Score: 0.992
Data Source: STRINGDB
PARK7
Tbio
Family: Enzyme
Novelty: 0.00119335
Score: 0.99
Data Source: STRINGDB
APP
Tchem
Novelty: 0.00011446
Score: 0.985
Data Source: STRINGDB
Publication Statistics
PubMed Score  4602.11

PubMed score by year
PubTator Score  4467.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV
1-70
VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
70-140
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA