You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CYP3A4
Cytochrome P450 3A4

Protein Summary
Description
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2-exo-monooxygenase. The enzyme also hydroxylates etoposide (PubMed:11159812). Catalyzes 4-beta-hydroxylation of cholesterol. May catalyze 25-hydroxylation of cholesterol in vitro (PubMed:21576599). This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This en ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000336411
  • ENSP00000337915
  • ENSG00000160868

Symbol
  • CYP3A3
  • HLP
  • CP33
  • CP34
  • CYP3A
  • NF-25
  • CYP3A3
  • P450C3
  • CYPIIIA3
  • CYPIIIA4
  • P450PCN1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
drug
1
molecular function
0.96
disease
0.85
pathway
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4930.19   (req: < 5)
Gene RIFs: 564   (req: <= 3)
Antibodies: 551   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4930.19   (req: >= 5)
Gene RIFs: 564   (req: > 3)
Antibodies: 551   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 54
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 16
Protein Data Bank (40)
1 – 5 of 40
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (46)
Aflatoxin activation and detoxification (R-HSA-5423646)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aflatoxin activation and detoxification
Reactome
Biological oxidations
Reactome
Biosynthesis of DHA-derived SPMs
Reactome
Biosynthesis of maresin-like SPMs
Reactome
Biosynthesis of maresins
Name
Explore in Pharos
Explore in Source
Aflatoxin activation and detoxification
Biological oxidations
Biosynthesis of DHA-derived SPMs
Biosynthesis of maresin-like SPMs
Biosynthesis of maresins
Gene Ontology Terms (35)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Protein-Protein Interactions (223)
1 – 10 of 223
CYP3A7
Tclin
Family: Enzyme
Novelty: 0.00963214
p_int: 0.999999995
p_wrong: 5e-9
Score: 0.957
Data Source: BioPlex,STRINGDB
UGT1A8
Tbio
Family: Enzyme
Novelty: 0.00173655
Score: 0.975
Data Source: STRINGDB
CYP2C9
Tchem
Novelty: 0.00054291
Score: 0.97
Data Source: STRINGDB
UGT2B7
Tchem
Family: Enzyme
Novelty: 0.00440085
Score: 0.969
Data Source: STRINGDB
FMO3
Tbio
Family: Enzyme
Novelty: 0.0062911
Score: 0.967
Data Source: STRINGDB
FMO1
Tbio
Family: Enzyme
Novelty: 0.03152164
Score: 0.963
Data Source: STRINGDB
NR1I2
Tchem
Family: NR
Novelty: 0.00069906
Score: 0.962
Data Source: STRINGDB
UGT1A1
Tchem
Family: Enzyme
Novelty: 0.00173218
Score: 0.961
Data Source: STRINGDB
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.96
Data Source: STRINGDB
CES1
Tchem
Family: Enzyme
Novelty: 0.00126542
Score: 0.958
Data Source: STRINGDB
Publication Statistics
PubMed Score  4930.19

PubMed score by year
PubTator Score  5713.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGK
1-70
VWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSG
70-140
KLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKL
140-210
LRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN
210-280
SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTV
280-350
LQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
350-420
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVV
420-490
LKVESRDGTVSGA
490-503
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA