You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DCX
Neuronal migration protein doublecortin

Protein Summary
Description
Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration. This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded prote ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000358070
  • ENSP00000350776
  • ENSG00000077279
  • ENST00000371993
  • ENSP00000361061
  • ENST00000488120
  • ENSP00000419861
  • ENST00000496551
  • ENSP00000490448
  • ENST00000635795
  • ENSP00000489635

Symbol
  • DBCN
  • LISX
  • DC
  • DBCN
  • LISX
  • SCLH
  • XLIS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase
0.97
hub protein
0.79
molecular function
0.76
transcription factor perturbation
0.68
biological term
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1008.62   (req: < 5)
Gene RIFs: 46   (req: <= 3)
Antibodies: 657   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1008.62   (req: >= 5)
Gene RIFs: 46   (req: > 3)
Antibodies: 657   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
L1CAM interactions
Reactome
Neurofascin interactions
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
L1CAM interactions
Neurofascin interactions
Gene Ontology Terms (15)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (131)
1 – 10 of 131
NMNAT3
Tbio
Family: Enzyme
Novelty: 0.04064292
p_int: 0.999995348
p_ni: 2.45e-7
p_wrong: 0.000004408
Score: 0.543
Data Source: BioPlex,STRINGDB
DCLK1
Tchem
Family: Kinase
Novelty: 0.00716245
p_int: 0.999989667
p_ni: 1e-9
p_wrong: 0.000010332
Score: 0.884
Data Source: BioPlex,STRINGDB
DIS3
Tbio
Family: Enzyme
Novelty: 0.01227304
p_int: 0.999268835
p_ni: 0.000731165
Score: 0.211
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.994650398
p_ni: 0.005349599
p_wrong: 4e-9
Data Source: BioPlex
DGUOK
Tbio
Family: Kinase
Novelty: 0.00695477
p_int: 0.99406121
p_ni: 0.005938789
p_wrong: 1e-9
Data Source: BioPlex
HAX1
Tbio
Novelty: 0.00851075
p_int: 0.994005006
p_ni: 0.005994988
p_wrong: 6e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
NDUFA10
Tclin
Family: Enzyme
Novelty: 0.10106317
p_int: 0.983344425
p_ni: 0.016655574
p_wrong: 1e-9
Data Source: BioPlex
LGALS9C
Tdark
Novelty: 0.90909091
p_int: 0.97509093
p_ni: 0.024909054
p_wrong: 1.6e-8
Data Source: BioPlex
RGL4
Tdark
Novelty: 0.625
p_int: 0.972499343
p_ni: 0.027498235
p_wrong: 0.000002422
Score: 0.359
Data Source: BioPlex,STRINGDB
DPF3
Tbio
Family: Epigenetic
Novelty: 0.09141321
p_int: 0.970168712
p_ni: 0.02983126
p_wrong: 2.7e-8
Score: 0.194
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1008.62

PubMed score by year
PubTator Score  346.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY
1-70
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK
70-140
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV
140-210
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA
210-280
TAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY
280-350
LPLSLDDSDSLGDSM
350-365
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSLGDSM