You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MEN1
Menin

Protein Summary
Description
Essential component of a MLL/SET1 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3 (H3K4). Functions as a transcriptional regulator. Binds to the TERT promoter and represses telomerase expression. Plays a role in TGFB1-mediated inhibition of cell-proliferation, possibly regulating SMAD3 transcriptional activity. Represses JUND-mediated transcriptional activation on AP1 sites, as well as that mediated by NFKB subunit RELA. Positively regulates HOXC8 and HOXC6 gene expression. May be involved in normal hematopoiesis through the activation of HOXA9 expression (By similarity). May be involved in DNA repair. This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is no ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312049
  • ENSP00000308975
  • ENSG00000133895
  • ENST00000315422
  • ENSP00000323747
  • ENST00000337652
  • ENSP00000337088
  • ENST00000377313
  • ENSP00000366530
  • ENST00000377321
  • ENSP00000366538
  • ENST00000377326
  • ENSP00000366543
  • ENST00000394374
  • ENSP00000377899
  • ENST00000394376
  • ENSP00000377901

Symbol
  • SCG2
  • MEAI
  • SCG2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.96
hub protein
0.94
disease perturbation
0.83
phenotype
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1916.96   (req: < 5)
Gene RIFs: 207   (req: <= 3)
Antibodies: 479   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1916.96   (req: >= 5)
Gene RIFs: 207   (req: > 3)
Antibodies: 479   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 43
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 48
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (29)
1 – 5 of 29
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deactivation of the beta-catenin transactivating complex
Reactome
Formation of the beta-catenin:TCF transactivating complex
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Deactivation of the beta-catenin transactivating complex
Formation of the beta-catenin:TCF transactivating complex
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism of proteins
Gene Ontology Terms (55)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (324)
1 – 10 of 324
CD226
Tbio
Novelty: 0.00453644
p_int: 0.958818487
p_ni: 0.041181513
Data Source: BioPlex
RBBP5
Tbio
Novelty: 0.0339304
Score: 0.989
Data Source: STRINGDB
ASH2L
Tbio
Family: Enzyme
Novelty: 0.02441135
Score: 0.987
Data Source: STRINGDB
WDR5
Tchem
Novelty: 0.00689807
Score: 0.98
Data Source: STRINGDB
SMAD3
Tbio
Family: TF
Novelty: 0.00058288
Score: 0.979
Data Source: Reactome,STRINGDB
KMT2D
Tbio
Family: Epigenetic
Novelty: 0.00631634
Score: 0.976
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.975
Data Source: Reactome,STRINGDB
KMT2A
Tchem
Family: Epigenetic
Novelty: 0.0006021
Score: 0.969
Data Source: STRINGDB
JUND
Tbio
Family: TF
Novelty: 0.00337776
Score: 0.957
Data Source: STRINGDB
HDAC1
Tclin
Family: Epigenetic
Novelty: 0.00083441
Score: 0.954
Data Source: STRINGDB
Publication Statistics
PubMed Score  1916.96

PubMed score by year
PubTator Score  1599.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD
1-70
PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI
70-140
QSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNED
140-210
RRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLER
210-280
YPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTA
280-350
TVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLR
350-420
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRR
420-490
ESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQS
490-560
EKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL
560-615
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL