You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PDCD1
Programmed cell death protein 1

Protein Summary
Description
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. Possible cell death inducer, in association with other factors. This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334409
  • ENSP00000335062
  • ENSG00000188389
  • ENST00000618185
  • ENSP00000480684
  • ENSG00000276977

Symbol
  • PD1
  • PD1
  • PD-1
  • CD279
  • SLEB2
  • hPD-1
  • hPD-l
  • hSLE1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
phenotype
0.83
disease
0.68
tissue sample
0.67
hub protein
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1263.63   (req: < 5)
Gene RIFs: 641   (req: <= 3)
Antibodies: 1947   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1263.63   (req: >= 5)
Gene RIFs: 641   (req: > 3)
Antibodies: 1947   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (290)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Immune System
Reactome
PD-1 signaling
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Immune System
PD-1 signaling
Protein-Protein Interactions (200)
1 – 10 of 200
RAB5IF
Tdark
Novelty: 7
p_int: 0.999980455
p_ni: 0.000019543
p_wrong: 2e-9
Data Source: BioPlex
POP5
Tbio
Family: Enzyme
Novelty: 0.06211823
p_int: 0.999690875
p_ni: 0.000200356
p_wrong: 0.000108769
Data Source: BioPlex
SFXN3
Tdark
Novelty: 0.24
p_int: 0.999572917
p_ni: 0.000427081
p_wrong: 1e-9
Data Source: BioPlex
SLC25A23
Tbio
Family: Transporter
Novelty: 0.2047077
p_int: 0.998225092
p_ni: 0.001773106
p_wrong: 0.000001802
Data Source: BioPlex
DAGLB
Tchem
Family: Enzyme
Novelty: 0.04727911
p_int: 0.997329418
p_ni: 0.002669811
p_wrong: 7.7e-7
Data Source: BioPlex
SMDT1
Tbio
Novelty: 0.02130362
p_int: 0.996571355
p_ni: 0.000696629
p_wrong: 0.002732017
Data Source: BioPlex
RHBDF2
Tbio
Family: Enzyme
Novelty: 0.02152024
p_int: 0.995140042
p_ni: 0.004788006
p_wrong: 0.000071951
Score: 0.162
Data Source: BioPlex,STRINGDB
DENND6A
Tbio
Novelty: 8
p_int: 0.991856325
p_ni: 0.008141345
p_wrong: 0.000002331
Data Source: BioPlex
SLC25A28
Tbio
Family: Transporter
Novelty: 0.07441091
p_int: 0.99146815
p_ni: 0.000003625
p_wrong: 0.008528225
Score: 0.173
Data Source: BioPlex,STRINGDB
INTS4
Tbio
Novelty: 0.05555556
p_int: 0.991417692
p_ni: 0.008582308
Data Source: BioPlex
Publication Statistics
PubMed Score  1263.63

PubMed score by year
PubTator Score  1771.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM
1-70
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA
70-140
ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK
140-210
EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE
210-280
DGHCSWPL
280-288
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL