You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GATA4
Transcription factor GATA-4

Protein Summary
Description
Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development and function (PubMed:24000169, PubMed:27984724). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (PubMed:27984724). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (PubMed:20081228). Required during testicular development (PubMed:21220346). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (PubMed:15734735). This gene encodes a member of the GATA family of zinc-finger transcrip ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000335135
  • ENSP00000334458
  • ENSG00000136574
  • ENST00000532059
  • ENSP00000435712
  • ENST00000643249
  • ENSP00000493647
  • ENSG00000285109
  • ENST00000647274
  • ENSP00000495511

Symbol
  • TOF
  • ASD2
  • VSD1
  • TACHD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.99
biological term
0.9
PubMedID
0.8
phenotype
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 846.56   (req: < 5)
Gene RIFs: 194   (req: <= 3)
Antibodies: 668   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 846.56   (req: >= 5)
Gene RIFs: 194   (req: > 3)
Antibodies: 668   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 49
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (55)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Factors involved in megakaryocyte development and platelet production
Gene expression (Transcription)
Generic Transcription Pathway
Hemostasis
Gene Ontology Terms (53)
Items per page:
10
1 – 10 of 16
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Genetic Interaction (IGI)
BHF-UCL
Inferred from Genetic Interaction (IGI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (339)
1 – 10 of 339
NKX2-5
Tbio
Family: TF
Novelty: 0.00147966
Score: 0.998
Data Source: Reactome,STRINGDB
MEF2C
Tbio
Family: TF
Novelty: 0.00288254
Score: 0.993
Data Source: STRINGDB
ZFPM2
Tbio
Family: TF
Novelty: 0.01483815
Score: 0.992
Data Source: STRINGDB
TBX5
Tbio
Family: TF
Novelty: 0.00371671
Score: 0.985
Data Source: STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.984
Data Source: STRINGDB
SRF
Tbio
Family: TF
Novelty: 0.00108543
Score: 0.98
Data Source: STRINGDB
BMP2
Tbio
Novelty: 0.00020018
Score: 0.976
Data Source: STRINGDB
HAND2
Tbio
Family: TF
Novelty: 0.00439742
Score: 0.971
Data Source: STRINGDB
NPPA
Tchem
Novelty: 0.00054421
Score: 0.967
Data Source: STRINGDB
HEY2
Tbio
Family: TF
Novelty: 0.00341896
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  846.56

PubMed score by year
PubTator Score  502.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGS
1-70
SGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAG
70-140
AGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDD
140-210
FSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTT
210-280
LWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNS
280-350
SNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT
350-420
SSKQDSWNSLVLADSHGDIITA
420-442
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA