You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HAP1
Huntingtin-associated protein 1

Protein Summary
Description
Originally identified as neuronal protein that specifically associates with HTT/huntingtin and the binding is enhanced by an expanded polyglutamine repeat within HTT possibly affecting HAP1 interaction properties. Both HTT and HAP1 are involved in intracellular trafficking and HAP1 is proposed to link HTT to motor proteins and/or transport cargos. Seems to play a role in vesicular transport within neurons and axons such as from early endosomes to late endocytic compartments and to promote neurite outgrowth. The vesicular transport function via association with microtubule-dependent transporters can be attenuated by association with mutant HTT. Involved in the axonal transport of BDNF and its activity-dependent secretion; the function seems to involve HTT, DCTN1 and a complex with SORT1. Involved in APP trafficking and seems to facilitate APP anterograde transport and membrane insertion thereby possibly reducing processing into amyloid beta. Involved in delivery of gamma-aminobutyric ac ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310778
  • ENSP00000309392
  • ENSG00000173805
  • ENST00000341193
  • ENSP00000343170
  • ENST00000347901
  • ENSP00000334002
  • ENST00000393939
  • ENSP00000377513

Symbol
  • HAP2
  • HLP1
  • HLP
  • HAP2
  • HIP5
  • hHLP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.96
kinase perturbation
0.81
histone modification site profile
0.78
cellular component
0.67
hub protein
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.88   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 216   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.88   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 216   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (60)
1 – 10 of 60
HTT
Tchem
Novelty: 0.00040613
Score: 0.901
Data Source: STRINGDB
NFYB
Tbio
Family: TF
Novelty: 0.00718551
Score: 0.888
Data Source: STRINGDB
REPIN1
Tbio
Family: TF
Novelty: 0.02058975
Score: 0.867
Data Source: STRINGDB
DCTN1
Tbio
Novelty: 0.00789738
Score: 0.865
Data Source: STRINGDB
KALRN
Tbio
Family: Kinase
Novelty: 0.0008876
Score: 0.84
Data Source: STRINGDB
AHI1
Tbio
Novelty: 0.01007029
Score: 0.839
Data Source: STRINGDB
GABRB1
Tclin
Family: IC
Novelty: 0.04413659
Score: 0.772
Data Source: STRINGDB
GABRB2
Tclin
Family: IC
Novelty: 0.02660189
Score: 0.756
Data Source: STRINGDB
NFYC
Tbio
Family: TF
Novelty: 0.01108426
Score: 0.751
Data Source: STRINGDB
GABRA1
Tclin
Family: IC
Novelty: 0.01400071
Score: 0.747
Data Source: STRINGDB
Publication Statistics
PubMed Score  90.88

PubMed score by year
PubTator Score  158.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQFLSEARTGARP
1-70
ASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGRGTGKAAGIWKTPAAYVGRRP
70-140
GVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYLLEELLPPVWESVTYGMVLQRERDLNTAARI
140-210
GQSLVKQNSVLMEENSKLEALLGSAKEEILYLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQE
210-280
EEEAEEDLQCAHPCDAPKLISQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLIL
280-350
ECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQM
350-420
QLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETLPGFQETLAEE
420-490
LRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGLMLAADIMRGEDFTPAEEF
490-560
VPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQ
560-630
LANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR
630-671
MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQFLSEARTGARPASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGRGTGKAAGIWKTPAAYVGRRPGVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYLLEELLPPVWESVTYGMVLQRERDLNTAARIGQSLVKQNSVLMEENSKLEALLGSAKEEILYLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQEEEEAEEDLQCAHPCDAPKLISQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLILECVEQFSEASQQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQMQLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEEGLMLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGECPHGALPAASRTSCRSSCR