You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARSI
Arylsulfatase I

Protein Summary
Description
Displays arylsulfatase activity at neutral pH, when co-expressed with SUMF1; arylsulfatase activity is measured in the secretion medium of retinal cell line, but no activity is recorded when measured in cell extracts. This gene encodes a protein that belongs to a large family of sulfatases that hydrolyze sulfate esters and sulfamates. Members of this family play a role in several cellular processes, including hormone synthesis, cell signaling in development and degradation of macromolecules. The protein encoded by this gene is thought to be secreted, and to function in extracellular space. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328668
  • ENSP00000333395
  • ENSG00000183876
  • ENST00000515301
  • ENSP00000426879

Symbol
  • ASI
  • SPG66
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.59
protein domain
0.58
PubMedID
0.58
histone modification site profile
0.49
disease
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.57   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 167   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.57   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 167   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Gamma carboxylation, hypusine formation and arylsulfatase activation (R-HSA-163841)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Glycosphingolipid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Gamma carboxylation, hypusine formation and arylsulfatase activation
Glycosphingolipid metabolism
Metabolism
Metabolism of lipids
Metabolism of proteins
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
HGNC
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (36)
1 – 10 of 36
NOL11
Tbio
Novelty: 0.72289157
p_int: 0.967184222
p_ni: 0.032815694
p_wrong: 8.4e-8
Score: 0.309
Data Source: BioPlex,STRINGDB
AHCYL2
Tbio
Family: Enzyme
Novelty: 0.10791598
p_int: 0.866866847
p_ni: 0.133133152
p_wrong: 2e-9
Score: 0.223
Data Source: BioPlex,STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.837239914
p_ni: 0.162760086
Score: 0.153
Data Source: BioPlex,STRINGDB
SUMF1
Tbio
Family: Enzyme
Novelty: 0.01184153
Score: 0.974
Data Source: STRINGDB
SUMF2
Tbio
Family: Enzyme
Novelty: 0.14379242
Score: 0.952
Data Source: STRINGDB
ARSK
Tbio
Family: Enzyme
Novelty: 0.05937509
Score: 0.948
Data Source: STRINGDB
ARSH
Tbio
Family: Enzyme
Novelty: 0.00554685
Score: 0.941
Data Source: STRINGDB
STS
Tchem
Family: Enzyme
Novelty: 0.0020382
Score: 0.925
Data Source: STRINGDB
ARSE
Tbio
Family: Enzyme
Novelty: 0.00067857
Score: 0.922
Data Source: STRINGDB
ARSG
Tbio
Family: Enzyme
Novelty: 0.0408666
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  111.57

PubMed score by year
PubTator Score  95.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHTLTGFSLVSLLSFGYLSWDWAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIE
1-70
TPTLDRLAAKGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPQQPNCLPLDQVTLPQKLQEAGY
70-140
STHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGENVAWGLSGQYSTM
140-210
LYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWA
210-280
LKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKQRTSRALMHITDW
280-350
YPTLVGLAGGTTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHAQHGSLEGGFGIWNTAVQAAIR
350-420
VGEWKLLTGDPGYGDWIPPQTLATFPGSWWNLERMASVRQAVWLFNISADPYEREDLAGQRPDVVRTLLA
420-490
RLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEEEEEGRARSFSRGRRKKKCKICKLRSFFRKL
490-560
NTRLMSQRI
560-569
MHTLTGFSLVSLLSFGYLSWDWAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAKGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPQQPNCLPLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKQRTSRALMHITDWYPTLVGLAGGTTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHAQHGSLEGGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLATFPGSWWNLERMASVRQAVWLFNISADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEEEEEGRARSFSRGRRKKKCKICKLRSFFRKLNTRLMSQRI